SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000315 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000000315
Domain Number - Region: 74-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0051
Further Details:      
 
Domain Number - Region: 41-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000301
Family LDL receptor-like module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000315   Gene: ENSPMAG00000000282   Transcript: ENSPMAT00000000315
Sequence length 164
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477236:114578:118932:1 gene:ENSPMAG00000000282 transcript:ENSPMAT00000000315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAMICISLFASVWCWHIATRWHRCSSLSSRSQRPLYDETKDFTCLDGSKTMPFDRVNDD
YCDCKDGSDEPGTSACPNGNFHCTNAGYRPQNIPSSRVNDGICDCCDTTDEYNSGAVCEN
TCKELGQKDRENMARQAEVAAEGFRIKQQLMEETKRGKEEKQVR
Download sequence
Identical sequences S4R535
ENSPMAP00000000315 ENSPMAP00000000315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]