SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000908 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000000908
Domain Number 1 Region: 991-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000902
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 358-415
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000209
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 1831-1884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000811
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 4 Region: 1624-1683
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000301
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 5 Region: 800-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000051
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 6 Region: 1390-1440
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000144
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 7 Region: 2091-2137
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 8 Region: 520-571
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 9 Region: 2572-2621
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000981
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 1146-1195
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000432
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 11 Region: 206-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 12 Region: 1771-1829
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 2520-2569
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000301
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 1450-1492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000471
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 15 Region: 1990-2045
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 16 Region: 897-956
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000572
Family BSTI 0.019
Further Details:      
 
Domain Number 17 Region: 1219-1267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 18 Region: 306-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000916
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 19 Region: 267-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000107
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 48-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 21 Region: 857-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 22 Region: 1890-1948
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000327
Family BSTI 0.084
Further Details:      
 
Domain Number 23 Region: 2359-2410
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 24 Region: 2183-2239
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000113
Family ATI-like 0.036
Further Details:      
 
Domain Number 25 Region: 590-649
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 26 Region: 473-538
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000356
Family VWC domain 0.031
Further Details:      
 
Domain Number 27 Region: 2429-2480
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000294
Family ATI-like 0.083
Further Details:      
 
Domain Number 28 Region: 1276-1337
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000294
Family BSTI 0.011
Further Details:      
 
Domain Number 29 Region: 420-483
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000458
Family ATI-like 0.073
Further Details:      
 
Domain Number 30 Region: 1711-1760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 31 Region: 1058-1107
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000196
Family ATI-like 0.034
Further Details:      
 
Domain Number 32 Region: 1500-1557
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000376
Family BSTI 0.045
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000000908
Domain Number - Region: 2-38
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000374
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0094
Further Details:      
 
Domain Number - Region: 2490-2520
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00161
Family PMP inhibitors 0.0028
Further Details:      
 
Domain Number - Region: 1352-1409
Classification Level Classification E-value
Superfamily FnI-like domain 0.00314
Family Fibronectin type I module 0.093
Further Details:      
 
Domain Number - Region: 2045-2103
Classification Level Classification E-value
Superfamily FnI-like domain 0.0188
Family VWC domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000908   Gene: ENSPMAG00000000814   Transcript: ENSPMAT00000000912
Sequence length 2627
Comment pep:novel scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814 transcript:ENSPMAT00000000912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVTQKLPRYIFSRYLRILPVEYRTGIYLRSEILGCSLSPADGGPLGPGRCRAGEFRCGS
GECVAAATALCDGRVDCADFSDEKGCVLTTDVQMPTIPGVKGKPGVTGIPGVDVKPGVTG
EPGAIWGPGEPPSVTGHVSGTGEPFVIGKPGKPTRKPGMAGEPAAGPILPLGPWVTENHR
MTTPHPGRPLPGFTAAIWDGSVAPAARRPCLVGEFACASGGCVDAALVCDGKRDCPDRSD
ERYCGMATPFPHLPTTPPGAVPGGRVPGRCSARQFSCASGECVSSEKRCDLHRDCLDGSD
ELDCLDCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPV
EGQWGAWSAWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSD
CGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCAEGCRCKPGLYLKSGRCVEAGE
CQCRVDGRVYKPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTG
SQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSAWSR
CTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCGVRPCPDICRAMNTSA
ALCQVNSGCTLVEVILEYLPLCSPMGISIAGVLFELGNTLTVKKKTSFFVEWSNKEQGSA
SAHRPHFSSSDVARSLHMNSEAGAMHFVVNTHAVITTSHVPPSGTHTHSLQHPVYTSDLG
QDWLAIITCVNGEMQCGSLPCSVDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGG
RGCSGLPVEVAYCGLLPCKAVWGEWEAWSGCSASCGGGVRVRSRTCPTPAPPPHGQTLSC
PEGKVWRLCHADEPITCADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRISECPCFVGG
SVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRF
CTEPPPAGEGRDCGGPGSEERVCNTHACTHRNCSEVAGSYYSHCGPPCPRTCDDVSFCSW
SCEPGCYCTDGRLMNGEGKACVDKQDCTCLDINTGRRHPPGDTVPHADGCNNCTCMHGAL
VCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRD
VGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAGGAAVRTRECNSPTPRFGGAECEGN
STVSRPCQGDPSSCPDCPEGQVVLPCGKPCPRSCEDLRSGVLCVEPPAECRPACACPGDL
VLREDGTACVPPSRCPCRYRPPRPPHSHGRDRECRPAWILVHPGETVAIRCNNCTCESGQ
LSCTELACRIDGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKEC
RARSCVDSWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPCPGLATHSKACNTHVCQASAG
CPADKLFRECVQDEECPYTCAHVRGEAECRGETCEEGCHCPVGTWLHQGRCVQECPCVLD
EATAVLLWEQSALSAAEKAADQGALRDDGTAVFLGQEIPSGASITHECSNCTCAHGNLRC
AARPCPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHT
PDCRAAYTTPSPANVTIAPMPGVRSADTEGFGSWTPWSPCSRTCSDPELPALKTRVRFCA
PRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCGVGQQQRMRT
YNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACT
NPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFACVDP
EHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRI
ECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQVKPC
DLGSCPPLCRHGNWERYLGDVWLEGECEQCQCTPEGSFCQVIDCRDYEHCFYWAPWSDCT
TSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPVISWSSLSNREPLASTAE
AAGHRKSTQETPLSLPLPVPEGVCPEPLVFDPCGSPCSQYCGGRTLGTECVQECVPGCYC
PQGLLEQNGTCVDGAECGCVHLLTEAEGSKPIPSLIAPGSRVTVGCLECLCEDGQLHCSN
DSCQGAGVLGAWSEWTTCRPCVPPSILGSAPSSHASSRSGKAAYRPQMGRSWDPAETCTA
PAMEERTCADAVACSDDVCVWGAWGPWGGCREPCSGGFRVRQRAPLAPADPTGPRARCHG
ARLQSESCNTATCPVCAAGERCEDRGKAFLSTCANQCPRSCSDLWEHVECLQGSCREGCR
CPEGWLLQDRACVPVAQCRCGLPSPNASQEYRPGEVVRVDCNECVCVKGTFVCTEHVCPE
LGPWSAWGECSRSCGGGTRARHRDCPDASAPHACPGEPQQSEACSPQPCRADCVLGDWAA
WSSCSASCGGGVSSRNRSVVTAAAFGGAECPEPLVAQRSCNNYNCSE
Download sequence
Identical sequences S4R6S8
ENSPMAP00000000921 ENSPMAP00000000908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]