SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000913 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000000913
Domain Number 1 Region: 940-997
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000392
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 2030-2081
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000654
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 301-358
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 1775-1828
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000798
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 5 Region: 740-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000111
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 6 Region: 1585-1644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000288
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 7 Region: 463-514
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000275
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 8 Region: 997-1055
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000106
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 9 Region: 1153-1202
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000419
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 149-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 11 Region: 1715-1773
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 1398-1444
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 13 Region: 2534-2583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 846-905
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000556
Family BSTI 0.019
Further Details:      
 
Domain Number 15 Region: 1226-1274
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 16 Region: 249-298
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000902
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 17 Region: 210-247
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 18 Region: 1935-1984
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 19 Region: 6-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 797-842
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 21 Region: 1834-1892
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000327
Family BSTI 0.084
Further Details:      
 
Domain Number 22 Region: 2373-2424
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 23 Region: 2173-2229
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000011
Family ATI-like 0.036
Further Details:      
 
Domain Number 24 Region: 416-481
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000022
Family VWC domain 0.031
Further Details:      
 
Domain Number 25 Region: 533-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000301
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 26 Region: 363-426
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000229
Family ATI-like 0.078
Further Details:      
 
Domain Number 27 Region: 2443-2494
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000262
Family ATI-like 0.083
Further Details:      
 
Domain Number 28 Region: 1283-1344
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000278
Family BSTI 0.011
Further Details:      
 
Domain Number 29 Region: 1065-1116
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000119
Family ATI-like 0.041
Further Details:      
 
Domain Number 30 Region: 1655-1704
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 31 Region: 1449-1506
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000036
Family BSTI 0.045
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000000913
Domain Number - Region: 1989-2047
Classification Level Classification E-value
Superfamily FnI-like domain 0.000586
Family VWC domain 0.052
Further Details:      
 
Domain Number - Region: 2504-2534
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00157
Family PMP inhibitors 0.0028
Further Details:      
 
Domain Number - Region: 1371-1395
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0549
Family PMP inhibitors 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000913   Gene: ENSPMAG00000000814   Transcript: ENSPMAT00000000917
Sequence length 2583
Comment pep:novel scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814 transcript:ENSPMAT00000000917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLGPGRCRAGEFRCGSGECVAAATALCDGRVDCADFSDEKGCVPLQHLITKSPSTAKFPL
GPEWTTDESGGARRGVTGEPGVIRRPDQTGKPGVKGKQGVTGEPGVTGHVSGTGKPGKPT
RKPGMAGEPGRPLPGFTAAIWDGSVAPAARRPCLVGEFACASGGCVDAALVCDGKRDCPD
RSDERYCGMATPFPHLPTTPPGAVPGGRVPGRCSARQFSCASGECVSSEKRCDLHRDCLD
GSDELDCLDCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQA
CPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCAR
PSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCVEGCRCKPGLYLKSGRCVE
AGECQCRVDGRVYKPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPC
RTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPCPGDEAPEEGGDGDRGGWGQWSA
WSRCTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCGVRPCPVKKKTSF
FVEWSNKEQLCIQNIGHAGTSCCALATGNTQCMAXRLLLRSASAHRPHFSSSDVARSLHM
NSEAGAMHFVVNTHAVITTSHVPPSVSCGKVKLLHSPKTLPNHQVNSAKYLQKLLFYEIA
YYACHSRPCFLSGPVAIAPCCPLDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGG
RGCSGLPVEVAYCGLLPCKAVWGEWEAWSGCSASCGGGVRVRSRTCPTPAPPDMESCGTE
SCDGQTLSCPEGKVWRLCHADEPITCADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRI
SECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCG
LGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGGG
LRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRNCSEVAGSYYSHCGPPCPRTCD
DVSFCSWSCEPGCYCTDGRLMNGEGKACVDKQDCTCLDINTGRRHPPGDTVPHADGCNNC
TCMHGALVCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQ
RGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAGGAAVRTRECNSPTPRFG
GAECEGNSTVSRPCQGDPSSCPDCPEGQVVLPCGKPCPRSCEDLRSGVLCVEPPAECRPA
CACPGDLVLREDGTACVPPSRCPCRYRPPRPPHSHGRDRECRVQPAWILVHPGETVAIRC
NNCTCESGQLSCTELDSWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPCPGLATHSKACN
THVCQASAGCPADKLFRECVQDEECPYTCAHVRGEAECRGETCEEGCHCPVGTWLHQGRC
VQECPCVLDEATAVLLWEQSALSAAEKAADQGSEVGGRAPLNLTALRDDGTAVFLGQEIP
SGASITHECSNCTCAHGNLRCAARPCPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEP
APRHGGRPCTGPTMDIKYCHTPDCRGERSADTEGFGSWTPWSPCSRTCSDPELPALKTRV
RFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCGVGQQQ
RMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRV
RACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFA
CVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCS
HGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQ
VKPCDLGSCPPLCRHGNWERYLGDVWLEGECEQCQCTPEGSFCQVIDCRVDGGWTPWAPW
SDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPVHDGVVDVNKWRLG
TMESNNSNSRECGEIRRGGANLNGMCRNEYLMIDFLVKLSNREPLASTAEAAGHRKSTQE
TPLSLPLPVPEGVCPEPLVFDPCGSPCSQYCGGRTLGTECVQECVPGCYCPQGLLEQNGT
CVDGAECGCVHLLTEAEGSKPIPSLIAPGSRVTVGCLECLCEDGQLHCSNDSCQGAGVLG
AWSEWTTCRPCVPPSILVGGHLRPFLRPLHEGSLNASELPEHLRPFLPTQRRSGKAAYRP
QMGRSWDPAETCTAPAMEERTCADAVACSDDVCVWGAWGPWGGCREPCSGGFRVRQRAPL
APADPTGPRARCHGARLQSESCNTATCPVCAAGERCEDRGKAFLSTCANQCPRSCSDLWE
HVECLQGSCREGCRCPEGWLLQDRACVPVAQCRCGLPSPNASQEYRPGEVVRVDCNECVC
VKGTFVCTEHVCPELGPWSAWGECSRSCGGGTRARHRDCPDASAPHACPGEPQQSEACSP
QPC
Download sequence
Identical sequences S4R6T3
ENSPMAP00000000913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]