SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000921 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000000921
Domain Number 1 Region: 777-834
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000366
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 1855-1906
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000602
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 149-206
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 4 Region: 1600-1653
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000732
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 5 Region: 1410-1469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 6 Region: 575-633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000445
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 7 Region: 311-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.00086
Further Details:      
 
Domain Number 8 Region: 834-892
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000981
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 9 Region: 990-1039
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000392
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 10 Region: 1235-1281
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 11 Region: 1540-1598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 2362-2411
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 13 Region: 683-742
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000507
Family BSTI 0.019
Further Details:      
 
Domain Number 14 Region: 1063-1111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 15 Region: 97-146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000837
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 16 Region: 58-95
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 1760-1809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 19 Region: 1659-1717
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000294
Family BSTI 0.084
Further Details:      
 
Domain Number 20 Region: 2201-2252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000392
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 21 Region: 264-329
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000544
Family VWC domain 0.031
Further Details:      
 
Domain Number 22 Region: 2010-2064
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000121
Family ATI-like 0.036
Further Details:      
 
Domain Number 23 Region: 381-440
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 24 Region: 211-274
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000213
Family ATI-like 0.078
Further Details:      
 
Domain Number 25 Region: 1120-1181
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000213
Family BSTI 0.011
Further Details:      
 
Domain Number 26 Region: 2271-2320
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000818
Family ATI-like 0.083
Further Details:      
 
Domain Number 27 Region: 1480-1529
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 28 Region: 902-951
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000152
Family ATI-like 0.034
Further Details:      
 
Domain Number 29 Region: 1286-1343
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000327
Family BSTI 0.045
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000000921
Domain Number - Region: 635-672
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number - Region: 1814-1872
Classification Level Classification E-value
Superfamily FnI-like domain 0.000544
Family VWC domain 0.052
Further Details:      
 
Domain Number - Region: 2332-2362
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00145
Family PMP inhibitors 0.0028
Further Details:      
 
Domain Number - Region: 1208-1232
Classification Level Classification E-value
Superfamily PMP inhibitors 0.051
Family PMP inhibitors 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000921   Gene: ENSPMAG00000000814   Transcript: ENSPMAT00000000925
Sequence length 2411
Comment pep:novel scaffold:Pmarinus_7.0:GL477542:4188:92377:1 gene:ENSPMAG00000000814 transcript:ENSPMAT00000000925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLVGEFACASGGCVDAALVCDGKRDCPDRSDERYCGMATPFPHLPTTPPGAVPGGRVPGR
CSARQFSCASGECVSSEKRCDLHRDCLDGSDELDCLDCVVSPWTEWSQCSRSCGLGVMFR
QRDVLREEQTGGSCNRTLMGSRACFMQACPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCS
APPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLD
KSPDCRVPCVEGCRCKPGLYLKSGRCVEAGECQCRVDGRVYKPGQVFSTANCSNCSCRDG
TVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRD
CNAGPCPGDEAPEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRCNATAVDDV
TGDPCPEEDAQTELCGVRPCPGEWSCAASDCAAAAVVRSRRRNSLTCSQPPVGLGQKTRS
FIIHICRAMNTSAALCQVNSGCTLVEVILEYLPLCSPMGISIAGVLFELGNTLTXPTIAG
SASAHRPHFSSSDVARSLHMNSTCVNGEMQCGSLPCSVDCGWSEWTAWSLCTKTCDVGTR
RRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKAVWGEWEAWSGCSASCGGGVRAHTMC
SIRNVPQPWNYCNQYRNAADGQTLSCPEGKVWRLCHADEPITCADLGRDLTFSGRECHPG
CYCPNGTLLLNQTCVRISECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVD
GAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAW
SGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRNCSEV
AGSYYSHCGPPCPRTCDDVSFCSWSCEPGCYCTDGRLMNGEGKACVDKQDCTCLDINTGR
RHPPGDTVPHADGCNNCTCMHGALVCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRT
CACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSACDACAG
GAAVRTRECNSPTPRFGGAECEGNSTVSRPCQGDPSSCPDCPEGQVVLPCGKPCPRSCED
LRSGVLCVEPPAECRPACACPGDLVLREDGTACVPPSRCPCRYRPPRPPHSHGRDRECRV
QPAWILVHPGETVAIRCNNCTCESGQLSCTELDSWPWSEWSPWANCSVGCGGGEQTRHRS
CLHPPCPGLATHSKACNTHVCQASAGCPADKLFRECVQDEECPYTCAHVRGEAECRGETC
EEGCHCPVGTWLHQGRCVQECPCVLDEATAVLLWEQSALSAAEKAADQGALRDDGTAVFL
GQEIPSGASITHECSNCTCAHGNLRCAARPCPVDGRLSSWSGWERCSRTCGGLGRMTRTR
TCSEPAPRHGGRPCTGPTMDIKYCHTPDCRGERSADTEGFGSWTPWSPCSRTCSDPELPA
LKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCG
VGQQQRMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGG
RSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADL
QQGFACVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCA
DCTCSHGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQ
GERSQVKPCDLGSCPPLCRHGNWERYLGDVWLEGECEQCQCTPEGSFCQVIDCRVDGGWT
PWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPDDGVVDVNK
WRLGTMESNNSNSRECGEIRRGGANLNGMCRNEYLMISWSSIDLLALNIIIDQDFNFPIA
SRSLPLLRQPVIENLPKRHLCPCLCQCEGVCPEPLVFDPCGSPCSQYCGGRTLGTECVQE
CVPGCYCPQGLLEQNGTCVDGAECGCVHLLTEAEGSKPIPSLIAPGSRVTVGCLECLCED
GQLHCSNDSCQGAGVLGAWSEWTTCRPCVPPSILVGGHLRPFLRPLHEGSLNASELPEHL
SGKAAYRPQMGRSWDPAETCTAPAMEERTCADAVACSDDVCVWGAWGPWGGCREPCSGGF
RVRQRAPLAPADPTGPRARCHGARLQSESCNTATCPVCAAGERCEDRGKAFLSTCANQCP
RSCSDLWEHVECLQGSCREGCRCPEGWLLQDRACVPVAQCRCGLPSPNASQEYRPGEVVR
VDCNECVCVKGTFVCTEHVCPELGPWSAWGECSRSCGGGTRARHRDCPDASAPHACPGEP
QQSEACSPQPC
Download sequence
Identical sequences S4R6U1
ENSPMAP00000000921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]