SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000000978 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000000978
Domain Number 1 Region: 74-181,212-244
Classification Level Classification E-value
Superfamily C-type lectin-like 8.25e-17
Family C-type lectin domain 0.0086
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000000978
Domain Number - Region: 240-305
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000000978   Gene: ENSPMAG00000000888   Transcript: ENSPMAT00000000982
Sequence length 433
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477303:58412:65762:1 gene:ENSPMAG00000000888 transcript:ENSPMAT00000000982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCSSDQFACWSGKIKCIPLSWQCDGWASCEDNSDEANCPGPTEEVWIYQSRDRPENKGPP
GDNSRLQTTNIAADMCARFTEKCPLGWRYYESTASCYRAYATADSYWEAAQLCGQAGGYL
ATLTSDLELQFILSQDWGLEERDGLPREHGRFWVGYQYIVTNRSKNSLEGHWQEVQFKGV
GSHQEVVLPPDKVPTFGAAISEQAEVLCGQLQCFHYPSLRHRGLHSWYAENCNQKAPFLC
KQEKTCIDIRENVVVEGQDFTPRGSDPCLMCKCHKGEAETCIAALCERPQACQRFQMDPR
ECCKFTCLDPAGGSFLDGMASGMRLIVSCISSFLILSLLLFLVHRLRQRRREHIESLIGA
NLHHLGLGRGRMHGFELGPESLGTGFTPLHLSDDGEGGAFHFSEPPPPYTAYKSPDSPPP
PEDPPPAYELAVS
Download sequence
Identical sequences S4R6Z8
ENSPMAP00000000978 ENSPMAP00000000978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]