SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001133 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001133
Domain Number 1 Region: 365-611
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-44
Family YWTD domain 0.00000686
Further Details:      
 
Domain Number 2 Region: 1211-1483
Classification Level Classification E-value
Superfamily YWTD domain 7.72e-44
Family YWTD domain 0.00000693
Further Details:      
 
Domain Number 3 Region: 1127-1201,1485-1525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 952-987
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 5 Region: 909-949
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 6 Region: 64-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 24-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 8 Region: 871-910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 9 Region: 149-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00045
Further Details:      
 
Domain Number 10 Region: 993-1037
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 109-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 190-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.00039
Further Details:      
 
Domain Number 13 Region: 827-867
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 14 Region: 236-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 15 Region: 714-751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 791-825
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 17 Region: 1038-1071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 18 Region: 278-322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000359
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 1-32
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000122
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 1079-1118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000001133
Domain Number - Region: 325-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000454
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1538-1571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00099
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001133   Gene: ENSPMAG00000001008   Transcript: ENSPMAT00000001137
Sequence length 1861
Comment pep:novel scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008 transcript:ENSPMAT00000001137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCKNNRCIPMRWLCDGDNDCGENED
ESNTTCTVRTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCN
NGRCINIRWRCDSDNDCADSSDEAGCNNTCADSQFSCKNGHCIPSQWVCDGDNDCGDVSD
ETHTCEFPARPLRQCREDEFRCAINGNCIPLRWRCDGDADCMDISDEKECDGQRRTCNPG
THFTCVSNGICIRKAWVCDGDNDCEDNSDEAGCHVYLCQSDKGGCSHNCTVTPVDGLVCS
CPKGMQLGEDRKTCNFTDYCARHLRCSQRCEQEKGAVKCGCYDGWRLMLDGKSCRSTADA
DPFVPFIIFSTRHEIRRIDLHSRDYSVLVPSLRNAIAIDFHFGQSTLYWTDVVDVRSRVI
RRAFINGTGVETIVTTDVMNTHGLAVDWISGNIYWIDHAFDVIEVARLNGSYRYVVVSEE
LDKPLAIAVHPQKGYLFWSEWGHSPRIERTLLDGTERMALVNSSIASPNGISIDYDEGKL
YWCDGQTDRIERVDLETGANRHVVLVATTSDMFSVSVFGSHIYWSDRMQDSGSIKRGSKD
NAADAVDLRTGISTQLNELKVYNRDRQKGVALSACKHTNGGCEDLCLVDEYGEVTCQCRG
ERTLVDRTRCVGARCVGVRCVAVRCVGARCVGVRLRCVGVRCVGSSEQGPDPSNATCADH
EFRCGNGVCLPNATRCNQLADCDDVSDEVGCGTSCGSQVTQNNMNACLDYVVQGNQRFXC
ACVCVRAAAAVATCAPSHFQLTSRRCVPRVWVCDRDDDCGDGSDEPANCTQTMCGADEFR
CKGTGRCIPDRWKCDGDDDCGDGSDEPRDECEDKTCEPYQFRCKNNRCIPGRWHCDYDND
CGDNSDEEGCTPRPCSESEFSCANGRCIAGRWRCDGDHDCMDGSDEKDCSLRCEQDQFQC
QNGHCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQCNSTLCKPFSWRCDGEDDCG
DNSDEDADHCRAFQCPPRRQFRCRNDRVCVSLDRVCDGINNCGDHSDEEHCGEPARGARA
CTAEEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPRVNECLSNACGFEASCHD
TLQGYYCSCRPGFQWNASISSCEDVDECLHFGTCSQVCNNTKGSHVCSCAENFVKVHHHS
CKANDSERTMIYVADNNQVRGLSPQRANARYTQVLLGDDSVRVHSMGVHVRTARLFWTNW
HLGSISSMELRPGAGRPRSVRDDTAAVVRLEIPGLRTPSGVAVDWVAGNLYWTDSGRDVV
EVAQLSGQNRKTLVSGMIDDPHAIALDPVRGKMYWSDWGNNAKIEQASMDGTRRRNFVEE
RVQWPTGLAVDYMNQRLYWADTKLSVISSIRLDGTDRVVAVSIKQGLLHPFAIDVFEDHI
YGVTYTNSRVFRVHKFGNGTVEFLTMGLSHATHALVFHPLKQPEAVANPCERKKCERLCL
LNPNGATCNCPNGHSLANGTCLKMPTPTPPAHCDSPGECTLLCANGGSCFLNERRQEKCK
CQARFTGERCDNDQCTEYCRNGGTCTASLSGAHTCACVSQHTISLCTELVSIGSNRCSLT
VPCIKSMWTMQVWHWPYRSGECGQPQVYPVCQSDRDVASSARSCERACSSSKCTACVRAL
SVGQRNQSRRWRCASPDMSTRAGPCPTRCQSNWEGVQCERSALSRSTGKESSKTLPVAVS
VVLLILVLVSVLAFFCYRRRGKRAKAFQHRRMTNGTMSLEIGNPTYNMYEGEAEAEEEDV
GELLNTNFTLDPSKTTNFMNPVYASLYLEGPSSRNSLGSTDEKKELLTKGGTQGVPGEPV
V
Download sequence
Identical sequences S4R7F3
ENSPMAP00000001133 ENSPMAP00000001133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]