SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001140 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001140
Domain Number 1 Region: 467-665
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-33
Family YWTD domain 0.0000289
Further Details:      
 
Domain Number 2 Region: 135-402
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-28
Family YWTD domain 0.0002
Further Details:      
 
Domain Number 3 Region: 71-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000262
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000001140
Domain Number - Region: 418-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family EGF-type module 0.0079
Further Details:      
 
Domain Number - Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0321
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001140   Gene: ENSPMAG00000001025   Transcript: ENSPMAT00000001145
Sequence length 666
Comment pep:novel scaffold:Pmarinus_7.0:GL476464:197894:249856:-1 gene:ENSPMAG00000001025 transcript:ENSPMAT00000001145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPLGKHQCLGTDLCIPHSKLCNGINDCSDGYDEGSHCEALSGNCTDIGCQHRCAVTREGP
VCYCENGQQVMPDKKGCKDFDECGLYGTCSQICRNTAGSFTCGCVEGYALQPDGRSCKKS
DDPHASAEPSEPPALLVVSSKSSIVPMHLNGTAVPSARPVTAYAPGTMDFSYAGHKVCWA
NRTAITPTGVLHCATMSSLGAFSSKTVIGINFVIYGVKEIRIDWLTGNLYLLDESYNHIV
VCDASGAFCVKLLDLGSEAIRSLALDPISGNIFFTIFGRNSRIERCDMDGSNCTKLVYSK
ITYPQAITLDVIAHLVYWADISFDYVEAVDYEGRKRHIVCRHVDRLFGLTIFENYIYGIS
IKYSASEHMSLVRVDRFNSSEVQVLAHTARVGAVFVHHSSKQPTVHGHACEPDEHGRRGG
CSDICLFSAGYKVRKCRCHRGFNLDSDGRSCTKPKHELFLLYGKAFPGVVRGIDMTGSVQ
DDFMIPVEMLVNPRAVDFHAATGFVYFADSSQFLIGRQKIDGTAREVLLANNVKNVEGIS
VDWMGGNIYWTDDRLKAVKVARLENASQSWKTLVTGEMVHPRSIVVDPSRGHMYWTDWEE
DLKSSRSGKIERAWMDGTHREVFVSSKTMLWVNGLSLDSSAGVLYWCDAFFNHISSIDIN
GSNRKV
Download sequence
Identical sequences S4R7G0
ENSPMAP00000001140 ENSPMAP00000001140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]