SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001309 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001309
Domain Number 1 Region: 53-327
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-87
Family Eukaryotic proteases 0.0000644
Further Details:      
 
Domain Number 2 Region: 2-36
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001309   Gene: ENSPMAG00000001180   Transcript: ENSPMAT00000001315
Sequence length 328
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479305:249343:254401:-1 gene:ENSPMAG00000001180 transcript:ENSPMAT00000001315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACPRGGFLCGSSSECVTKCNGIPDCPDKSDEMNCFCGAACPMQFQCAAGAECVALSAVCS
GSADCASGNDEKSCLGEEPAAKRMVKSRIVGGESALAGAWPWQASLWSGLTKNHHCGGSL
IHPKWVLTAAHCVYGKNCRVEALSDWTLFFGKLLLDKEGPMEQHRSIRQIVVHRQYVSSE
NDYDIALLELDSPVNLTEQVQTVCMPAASHAFLPGQMCWVSGWGTVIGNEFSLSNNMQEV
QLPLISQSDCIGSYDHATPRMLCAGYPDGGKDACQQGDSGGPLVCEDRGSWFLAGLVSWG
VGCGLVNKPGVYTRVTAFTKWINSIIAQ
Download sequence
Identical sequences S4R7X9
ENSPMAP00000001309 ENSPMAP00000001309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]