SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001576 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001576
Domain Number 1 Region: 207-491
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-47
Family Kelch motif 0.0062
Further Details:      
 
Domain Number 2 Region: 1485-1693
Classification Level Classification E-value
Superfamily Kelch motif 7.06e-20
Family Kelch motif 0.033
Further Details:      
 
Domain Number 3 Region: 30-121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000497
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1087-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 1220-1268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000198
Family Laminin-type module 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000001576
Domain Number - Region: 1082-1222
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000659
Family Growth factor receptor domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001576   Gene: ENSPMAG00000001413   Transcript: ENSPMAT00000001583
Sequence length 1695
Comment pep:novel scaffold:Pmarinus_7.0:GL479050:59115:90624:1 gene:ENSPMAG00000001413 transcript:ENSPMAT00000001583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLRRTLRGCLCCCWLLLALLVPCASGGDCRGKRLVLNGTHGEVTDGPGNYSANGNCEWL
ITAPSQGDHIVLKLRAIETECSYDFLFIYDGDSYSSPLIASLSGNTLPDAIVARSGKVSF
RTHQYKCRCRWISSRFTNCRIPNGIINPPQTAPVPMAGGLLGWGGGEECAQSFNGLLGTC
FIVPYGQCQCSSSLHVGVNCSLALRNNSDGNKWHLIAHTQAAFTPRLGAAGVFSHATGCL
YVFGGFTLSTVLNDLVKYNITSGKWENATPPVSPEGRYLHTAVEWQDGMLVFGGELARGR
LANSLWFYSPGAANWTRLSDEVAPLPSPPPGLAGHAAALVDDTLYIFGGRTEQEEFSSAI
YAFNLTSKAWRKEVPLAGLAPAALGHSMVFYPEGRMLLVFGGHQPSSTRFSNRVNSVHAY
HVDRRYWAHLGRDGSPSVPIERAFHSAVIMGTYMVVYGGNVHIHNGEEKCYANDVYFYHL
GCHQWVNKDDLIQSIPVVADDHVPLQGRFSHVAAVMNGNVLLVAGGYSGVPRGDLIAYKV
PMAVAQNTFASKTLLSPCSLNTALEACTKDPECAWCSTKSSNQACMSHQEALLLCREEST
VSLCLGVHRWLTGCQACLAFAAGGKRLPGSVPLSRLAEPLGWCVQHPACLRRQDNGSCSS
GGGGGGLVSGWWGTNPSFLTAFEDCRSRDFPPGVHWIKHFQPQNDKYPDEVYVIQNVSTV
LPALLLVRGRDGRENANVTAVYRGFLPRLLDSGGPHCKDERAMACHVTSRVSRCRGCSVI
WSHGVFASSPLIQSRSCRLAELVNVFPRPRRWSRYLFVMEGQQDSSSNLESRMGLTWNTD
NIDSRPIKSLHLEPYKSGDCDQHSNCPACLSDQLCGWCPVKASCQHRLGPAGAACAAEGG
VEVAPMLMPEECSLCSLCYVRTDCRSCAQDGLCEWLSKDLVCIRRGRIQGAVQDPKSCLK
PCYEMRSCSECLSEYSECAWCASTSECFPFSIYLAKYPNGQCRNWLDSVTSLRLCPNCSS
FDKCNDCLQSFQCGWCWSVANPTKGRCLLGDFEGPSFGGNCSLEVRAAHADVGTDQEVAW
SYGACPDVEECTLRLDNCHANASCVNTPDSFTCQCQRGFQGDGVVHCNKTCYNHCQHGKC
SGPPDFVCQCDLGWTSTSLQTNASGEECDVNCGCNLHSACSAGVGRCDECQEWTTGDRCQ
LCRTGSYGSAVQRATGCHPCQCNGHGDSARGECDVTSGACYCAGDTEGERCDRCRPGFYG
DPRAGGRCYLACDGRSFLYDVGGSSALGSAWGAGVAPGGHAYCVWVLHAASSTAAPCPPS
TLPSPPPALSLQRDYVYVYDGVPNFLSSGATQQAVWADPSLIAALCGGGSGQALSVEALS
AGILTVYVQGNFSGPSGGTMGFNATFTVAACDGDAGAGGESGRCLAGRVCQDGRCVCPAG
YGGPDCSAQSCPGSCGQELGRGWCHPVSRTCVCSANYSGPDCNSTRDPDWGLWELLMDSF
IEGVNGHVVKRFGHSLVAGPSKTLLLFGGYSPSLGIIGDLHSFHFTEVQPSSMVAAAGGS
ASLSPSARYFHAAAWFGARGLMIVVGGITSAGVANDTWAFNTSALTWQRSVHHKSGTLPP
VAGHTLSEREGDSLLLVGGYSQENGFNSHVYEYSAARAAWLPLATGGSPPTGLYGHTSVY
HSATQALFVNGGYRY
Download sequence
Identical sequences S4R8P5
ENSPMAP00000001579 ENSPMAP00000001576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]