SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001614 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001614
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-31
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 2 Region: 121-195
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-16
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001614   Gene: ENSPMAG00000001462   Transcript: ENSPMAT00000001622
Sequence length 197
Comment pep:novel scaffold:Pmarinus_7.0:GL490886:345:4014:-1 gene:ENSPMAG00000001462 transcript:ENSPMAT00000001622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGVVVVSLPGYLTSPGYPEDYPPHQTCSWQLRAPSPEQKLLINFNPHFDMEKNSCRFDY
VQVWDDGDEKSGDDSGKFCGTVAPAPILSSGPTLHVKFVSDYTTQGAGFSLRYELYKPGV
DCSRNFTAPSGRIASPGHPLGYPPNAACVFVVSPPPPHAYILLTFRTFHLEADPDDGSAS
EGSACKYDHVEVWDGLP
Download sequence
Identical sequences S4R8T3
ENSPMAP00000001614 ENSPMAP00000001614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]