SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001691 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001691
Domain Number 1 Region: 197-507
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.14e-40
Family Eukaryotic proteases 0.0028
Further Details:      
 
Domain Number 2 Region: 2-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000116
Family EGF-type module 0.007
Further Details:      
 
Domain Number 3 Region: 68-120
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000528
Family Complement control module/SCR domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001691   Gene: ENSPMAG00000001536   Transcript: ENSPMAT00000001700
Sequence length 507
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477289:67916:79948:-1 gene:ENSPMAG00000001536 transcript:ENSPMAT00000001700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACLSSPCQNDGTCVLDNSTLFKCFCLAGYTGSFCERVEEERLCPEPRLPRNGQVDRNASA
PAEERGTGGAGGYRAGSTLQVACRPPYVRQGRGGWLTCGANGAWTGRPAACVKVIHCREP
LLFARLRSSSSSLINRNREHPQHTKKGAKKVVLEPEAAAAPAPAASAGANESALAPGFYP
VHARLEFRCPAAWYQQTGSARRTCLRTGRWSGQAARCVPVCGRADGWNISGTPWPWKAAV
YRQGVGAGTGARADGAWLLVCAAALVSERSLVSTAHCVTHFGTSTPLKRTEVRVVLGGGH
GGDGKAEQIAKHAQVSNILVHRAYDPVLLDGDLAVIRLSGSADLSDRVQPVCLPPDRSST
ATTPAASPSSSSSSSGAAFVSGWRLSSNGSGPATDAGRPLSAQISIMGTAQCERELEARG
AAVPVTARMFCAPALPVGSGEASWCPAETGGIAATATRGAGGRPGGPWHLLGLVSWGHSG
GCQGRAGLPTGYTNVSAFTDWLRKVIK
Download sequence
Identical sequences S4R910
ENSPMAP00000001691 ENSPMAP00000001691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]