SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001811 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000001811
Domain Number - Region: 99-170
Classification Level Classification E-value
Superfamily HR1 repeat 0.0112
Family HR1 repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001811   Gene: ENSPMAG00000001652   Transcript: ENSPMAT00000001820
Sequence length 228
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL492440:292608:300020:-1 gene:ENSPMAG00000001652 transcript:ENSPMAT00000001820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPVQARRSPTRSVKGSSASGKPPGGALRTPRPQQAEHIYVSLRRGLGQLLKAHHDELESL
VAQQKGTKRDSRMAFFYELDKQLRATQRYLRHLEFHISKIEELYESYCIQGRLRDGARKM
MAAYQASRSSRLARAALLAVAREHRDYTESLCMLENELEKLLGEFHIQMKGLAGFARLCP
GDQYEVVVRYGRQRWKMRGRIDSADEQRWDSTEAVLSALLAEPLYVRV
Download sequence
Identical sequences S4R9D0
ENSPMAP00000001811 ENSPMAP00000001811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]