SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001826 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001826
Domain Number 1 Region: 1602-1747
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-43
Family C-type lectin domain 0.00000231
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-39
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 104-205
Classification Level Classification E-value
Superfamily C-type lectin-like 6.58e-24
Family Link domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1747-1806
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001826   Gene: ENSPMAG00000001649   Transcript: ENSPMAT00000001836
Sequence length 1834
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL478684:172:28670:1 gene:ENSPMAG00000001649 transcript:ENSPMAT00000001836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVVFHYRGPGSRYSLTFEAARAACRDIDAHIVTPEQLQAAFEDGLDQCDAGWVSDQSVRY
PIVHPRRKCDGDKIHDPGVRNYGVKSPNEMFDVYCYVGEFRGEVFHASAIGRLTLAGARD
HCETLGATLASPGQLFGAWRLAAFDRCDPGWLADGSVRYPIVRPRTNCGGPVAGVRTIYR
DKDRTGFPGPEQRYDAYCFRAIGAGPDDPEKTHARKEDGSGIRNYRITFDVPRMQCIKIH
EETDQSNVPHGETDESHITEGDVETSHISGEESHFSQSGTASETHEETDLFHVPQIETDE
SHMTEGDTETPDNAFTKSGTDVSYEIHEETDLSPVSPSGLDTFPLLEGQPDTSHTAIVSG
EEDSHTVQSGADVLLDIHEDVPASQGSESAIEGSHAAKGEIDTSSIIPVSGEESPVLHSG
TEGLHGTHGDDQVSQVGDGETDEAHVTEEKMETSHDAVASGEESEISQSGTGTPHELPSG
EESHITESGIGVPSDIHEDTLGPQAPHGTVDESHIVKGDTGTSQIAIASGEDSQFTDSGF
GVPSDIHEDSLAPQVPHSDVDESPIVESGVGVPSDIHEDSLAPQVPHSDVDESLIVESGV
GVPSDIHEDSLAPQVPHSDVDESLIVESGVGVPSDIHEDSLAPQVPHSDVDESLIVESGV
GVPSDIHEDSLAPQVPHSDVDESLIVESGVGVPSDIHEDSLAPQVPHSDVDESPIVESGV
GVPSDIHEDNLGPQAPHGTVDESHIVKGEAGTSHIAIASGEDSHITGSGFGVPSDIHEDS
LAPQVPHSGVDESHLSEEVDTSHITLASGEESHITESGIGASSEIHEDTLGPQAPHGMVD
ESHIVKGEAGTSHVAIASGEDSYITESGFGVPSDIHEDSLAPQVPHSDVDESLIVESGVG
APSDINEDTLTPQVHHGGVDSGFGVPSEKHEDTDLLIIPHVAIDESQTAEKESSSSHIVT
SGEHRVTAEEDSHASQSGFEAPITTHEETDTSQIVHAEDAGSSQVIISSGEPHLLETDES
QIVRGEVETSQSAVDVPELPVAGEADHSADISQEQLMPRSGNAKEAGGFPPTSIDTAALH
PEVTPLPTDTASVGHLDVIPYDGSAAEPGSSLAPEQSGLPSVPSQESGVEAFPTEQGSTA
VLEPEVGVGSGVAEPGGVVGATEEAPEATVVLGEGGESGVGEGRTPGGEGDLSGDFLLKS
GPGSQLPTDFTVPEQSGIEIGGAGSQVRVVTSSSPGRGGAGLADSGHHLSPKVTKMGTTL
RLSCDATPVAQSGVKIGEKIAEAGVASGEGPLPESEHVVPPGEEGLPSGEGPSDVPPAPP
GPTLLGEGPTTEVPARPSSEPTSAPDEASGAGESYPEWVAPPSLTPGVESVPPEEDESGE
LYPGSGEVVPVVTTTAAAGTGKDGDGEGAELAPVASGEEEFAESLGETGVMKQGSGSTEG
SVSGEDWGLAQSGQENETLVEGAPSVDVIPYGEEHLVPGISDEHPLTSAEGSTTEASSEI
EVGVASGEASTVGAVPSALPEIPPALGPDETSGITVGSTPDEQQQQQEEVVAIVAPPVEG
LLGTPPDIYQPAELLATAMQGSCSEVPCLNGATCTDTDGGLHVCHCALGYTGDTCQIDTQ
QCEVGWQKFQGHCYNFFPQRRNWEDAERDCRLHGSHLASILSSEEQRFINRMAQDYQWIG
LNDKMFEHDFRWSDGHTLQYENWRPAQPDSFFFDGEDCVVMIWHENGQWNDVPCNYYLPY
TCKRGAVSCGPPPIVENAMTFGRLKSRYEINAIVRYHCREGFIQRHFPVIRCQPDGKWVE
PRITCINLCFYSRNIQSDSTKIFPPVNPTEDSAH
Download sequence
Identical sequences S4R9E5
ENSPMAP00000001826 ENSPMAP00000001826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]