SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000001929 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000001929
Domain Number 1 Region: 192-344
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000782
Further Details:      
 
Domain Number 2 Region: 347-508
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000015
Further Details:      
 
Domain Number 3 Region: 64-182
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-32
Family Spermadhesin, CUB domain 0.0000206
Further Details:      
 
Domain Number 4 Region: 568-729
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-30
Family MAM domain 0.00054
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000209
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000001929   Gene: ENSPMAG00000001736   Transcript: ENSPMAT00000001939
Sequence length 736
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476444:333387:405756:1 gene:ENSPMAG00000001736 transcript:ENSPMAT00000001939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYDFVEIRDGADDSAPLLGKFCGNIAPPSQTSSGATLFIRFKSDYATQGAGFSLRYEIYK
TEYECSNTFTTPNGTLQSPGYPEPYGHNLECTYIISAPPQSEIVLRFHVFSLEAEPAAQP
DAECRFDRLEVWDGLPHASPKXGRYCGSKSPGEIKSVSGILSVTFNTDGGIAKDGFSATY
RMIQRKIIETVKCNQPLGMESLEIRDEQITASSMYPNKEWMPKQARLNNPVHAWTPAADS
NKEWIQADLGYLKILSGIATQGAISKDSKKSYYVTSYKMEVSSNGDDWMMLKEGITIIIL
RNNSDASSLVENKFSEPVLTRFVRVRPRSWENGIALRFELYGCHISDYPCSGMLGMLSGR
IQDGQLQSSSQRGLNWAPSSARLLSSAYGWAPMPPHGASHPVGEWLQVELGGRHTVRGII
LQGAKSGTVPDNRLHVRKFRLATSLDGETWEMISEDDSDLPKLFEGNSNYDTPELRKFEP
VVASWVRIYPERQAPGGAGIRMELLGCDSLGPTACGVTTSQTPQWCCADANGHSAAGPNF
PQSFGSTLHAIERLVMAGIRILSALPNYGFGCRFGRGLQRGTCGWLQGDDSAADLRWQVG
TCHKGPSHDHSSGQGNYAFVEVSERDEQGAARLLSPPVTPHSTYRCLQFWYHMSGGIDSQ
LSVNVRTQTPMGLQDETLWSLSGEQPASSWQEARAILPQHATPYQVILEGKMGDGHNGCL
AVDDVKFNDKIPLMHC
Download sequence
Identical sequences S4R9P8
ENSPMAP00000001929 ENSPMAP00000001929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]