SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002002 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002002
Domain Number 1 Region: 41-317
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-72
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000366
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002002   Gene: ENSPMAG00000001826   Transcript: ENSPMAT00000002012
Sequence length 320
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477038:52046:53820:-1 gene:ENSPMAG00000001826 transcript:ENSPMAT00000002012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRYTCNEPYYSMASGNGGLGLHYEGQLICNETGQWVDEMGSPNLPGCKPVCGLVRHARSK
RIIGGRFSHRGDFPWLAMLLLDNHFMGAGALLGDSWILTAAEIFTQDYGQVDVYLGLVDR
RGVLANDSAVMKVHVESVVLHPNFSRDEEDAHDHDVALLRLTEPVPLRKDISPICLPGRD
KGSGVTDQPPGPGHVGYVAGWGRITTTKLHGVTPRWQRYVALPVVAQDKCRCTYAGMEFA
GRTLTYTDNMFCAGVPGGGRDACKGDSGGPFAYMEPRSQRWVAAGITSWGVGCGQKGHYG
VYTNVSNYVEWIEGEMQQGG
Download sequence
Identical sequences S4R9X1
ENSPMAP00000002002 ENSPMAP00000002002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]