SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002120 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002120
Domain Number 1 Region: 171-332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-34
Family MAM domain 0.0027
Further Details:      
 
Domain Number 2 Region: 49-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-29
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 3 Region: 10-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 355-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000262
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002120   Gene: ENSPMAG00000001933   Transcript: ENSPMAT00000002131
Sequence length 386
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL485958:471:9857:-1 gene:ENSPMAG00000001933 transcript:ENSPMAT00000002131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLHCVSSLSILCSPGQFVCGDISCIPLSAFCDGVTDCNDSSDEVACNSGCDDNFLLTGTS
GSFNSMNFPENYENNANCRWIIRAPDGYAVQISFSAFDLENNYDFLKIFKGLGADKELQA
SLTGTSNPGDVRVFAHELTVEFTSDSSAVKSGFSASFSTFDFSALTNKDLVDCSFESGWC
YWDQDPYDSANWERLSGPTSPANTGPDVDHTFGNSSGMHLGPPAGFYIRNQKSGVAASIR
TFTLDPEPNPTCLKFWYHMYGVDVYRLSLSLRTEGVADVPLWVKEGNYGNQWHYGQLSFS
QPQNFQVVFEARRRAGSSEIALDDISLEPGACPALPYPEPTPIIPTTLPWHPTSGCDDNF
LFTGTSGSFNSMNFPGNYDNNANCRW
Download sequence
Identical sequences S4RA89
ENSPMAP00000002120 ENSPMAP00000002120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]