SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002270 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002270
Domain Number 1 Region: 15-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.08e-50
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 235-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000458
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002270   Gene: ENSPMAG00000002077   Transcript: ENSPMAT00000002281
Sequence length 280
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479497:27147:32665:-1 gene:ENSPMAG00000002077 transcript:ENSPMAT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLACTLLCVRALGSWADRSLQHEAASQGRLLSLKTYIAQGCNVNALTIDQVTPLHEACLG
GHVSCARALIQAGAMVNAMTIDGVTPLVNACVRGSPACVKLLLESGATLYCAAHTTPLHE
AAARGHVDVLETLLEFGANIDVELPHTGTALYAASLHGRDACVRALLRAGADVNKGCFRT
TPLHVASRAMHGGTILVGLLLEFGADVNVRDADGKRAVDYAHHAHPECTLQQLLQSHEED
PQSLTQICRLAIRKKLGRARLHMISCLPLPRIITNYLQYR
Download sequence
Identical sequences S4RAN9
ENSPMAP00000002270 ENSPMAP00000002270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]