SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002480 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002480
Domain Number 1 Region: 37-147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000745
Family Pentraxin (pentaxin) 0.06
Further Details:      
 
Domain Number 2 Region: 350-472,505-522
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000173
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 1184-1246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000375
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 4 Region: 1242-1311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000025
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 5 Region: 1309-1364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000695
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 6 Region: 242-362,426-462
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000916
Family Reprolysin-like 0.067
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000002480
Domain Number - Region: 549-588,773-817
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000574
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number - Region: 1106-1185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00315
Family Complement control module/SCR domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002480   Gene: ENSPMAG00000002256   Transcript: ENSPMAT00000002492
Sequence length 1509
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477255:50201:143552:-1 gene:ENSPMAG00000002256 transcript:ENSPMAT00000002492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMFDECSYVSTDKGWALGLAPWDESHGDSGGGGGAVGPSRFFFSLRTDRARSSSMVFART
RYEPAVWTHVAATYDGRAMSLYVDGARVARGTAQRGPLFSPRAVGCKALILGGHGSDPLG
GYRGHVAAPRLWSVARTHGEIRAGVPLSLCGADPPGLVMGESAVEQLRQRWKPVAKDGRF
PRREEADDPGVTPSDGPVLFAPTCGQTVCDDVGVIGSYNRHWWLRRGKVVRYRVINVHED
DRSNPTVTEEQIQLQHRELNAAFQPYNITWELTVKDVADSWLRRRVVLANCEASKIGNGA
CEVECNHTLTGYDGGECLTQRPPACHWGASNGRCNPECNNENYRYDNGDCCDPAVTDVAR
TCFDPDSPHRAYLSVQDLKETLRLDGATHLNVYFPTSLGDVLAGVAMWPWEKDALTHLGG
MALNPTYYGKPGHTHTMIHEIGHALGLYHVFRGVSEVEHCGDPCLEVEPSFETGDLCEDT
APVPRHKGCGDAEVDSKDMCGARRFYDAPFHNYMSYADDDCTSSFTPNQVARMHCYLDMV
YETWREEAGPTPVPLAPRVHQQGIDFLSLRWMPPISGQVFERQATGGGGGGAGGGGSQNL
STRDTVRRLQHKSRSHLSVESYADKTADVHLRPVAFESWKGNTKIHIFLLLLTVTRQTDG
TTMRRLYHHTHEYNRVRYAFLIFIINSSTALISTRPLLTKKTHTHQITLNVLSFFLITVP
EHRPNDAKIAMAQATNSSAVLDEGKVLYQENSQAQNGCNARHLPQPRDPPPKKILKTHND
NRHREFCARDVEEGAVYSYQVRVVSGSGFSEFSPPLVHRHGAAFCGDGTVDRSDGEECDD
GGVRDGDGCSAFCRLEKDFNCVGSPNVCYAYAGDGLCEEFEKEGSGLDCGIFTPPGHADQ
WVSQATASHQDSLHCPASVLVGPPALSKVYLHAHNSIDTPRAIRRYLLCVSVGNGCKSDV
AAPPPPPLKRERETESNVNFPYPRIATAVVIYFSADGIGRSLANRSQKYVHVSLIEDDGT
SYSLGSYPISCSFNPLVIPVTSPDPSAPQVLTRGVQVSMGSPEVAISGVALRSASQGDRP
HCEEEEDEEPRGSKSGERSCSRCDVCSMAVRVRDIFFLCTSVNGMTPGSQRCSVTCNHGF
QLYARGEKETNVSKASPAESVTLACASERWSGEVLCRPVDCGHPHPSLVPHAAFSCPRGT
ARGQSCSFQCRPPAQQKGTNTAVACLADGMWSHPEASCELVCLPPPALPHAELRTSQCAN
GTHKLDSVCKFRCRPGYRIAGGKGKSRPKNFQVRCTEDGRWEEGGCVPVLCKPPPTILHG
LYQCTRGFEAGSRCSITCKGKDKAVLNIRCTKNGVWKGQLRQCPNLNGECSPPESSGTVL
FMCDQGHKIGAQCNPSCNKPMHDPVVLPVNTSAEKLPYWVSVPRIQHIICTAVKKWYPDP
STMNCIKSCEDTFKGDGWCDPHNNRAYCQYDRGDCCASTANAKEVIPFGQPCDFQGECAC
RDPEARENR
Download sequence
Identical sequences S4RB99
ENSPMAP00000002480 ENSPMAP00000002480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]