SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002667 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002667
Domain Number 1 Region: 136-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-34
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 2 Region: 37-130
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-32
Family Link domain 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002667   Gene: ENSPMAG00000002434   Transcript: ENSPMAT00000002680
Sequence length 281
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476598:170562:181552:1 gene:ENSPMAG00000002434 transcript:ENSPMAT00000002680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMWLACALLGWIGEAHGWAFRDDVWHNSVLLEEAAGVFHIHSRHGRYLLSLREARAICA
YEGGALATIAQLREAQRAGLHNCVAGWLADARVAYPVTKASQKCSNGIVGVVDYGVRLNR
SERWDAYCYRRKVGTCGGRHMETALNLSSPDYPGYAALRSCVWTIRVPVSKRVRLSFLDF
DLERDKGCLADFLEVYDSYEDVSGLIDRFCGDDLPPVIVSTTNMMTLKFHSDASVGGRGF
LAYYEAVDPPTTVSSLQDSRVDPPALPTNATAVNPSAFPHL
Download sequence
Identical sequences S4RBT6
ENSPMAP00000002667 ENSPMAP00000002667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]