SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002873 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002873
Domain Number 1 Region: 599-837
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.41e-77
Family Eukaryotic proteases 0.0000696
Further Details:      
 
Domain Number 2 Region: 245-362
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.09e-28
Family Frizzled cysteine-rich domain 0.00024
Further Details:      
 
Domain Number 3 Region: 95-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 138-171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 447-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 64-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 502-584
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000249
Family Hepsin, N-terminal domain 0.036
Further Details:      
 
Domain Number 8 Region: 2-46
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000000262
Family Frizzled cysteine-rich domain 0.004
Further Details:      
 
Domain Number 9 Region: 372-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 170-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000109
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 11 Region: 413-445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000912
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002873   Gene: ENSPMAG00000002612   Transcript: ENSPMAT00000002887
Sequence length 843
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476390:483554:536504:1 gene:ENSPMAG00000002612 transcript:ENSPMAT00000002887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPCMSYCDAARSSCERAFTQVGLGWPEFLSCYHFHNDRKKETMSITWVCFTPQMFNGRK
IACGGFWCSSRLCISKKLVCNGYNDCGDWSDEKLCSCGAGEFRCGTGRCVALSQRCDGFN
DCGDLSDEAACHCDNAVWFRCGDGVCVSRAWVCDGDADCSDRSDELNCTCKSHGMQECDG
GLCIPPSYLCDGERDCEDGRDEEGCGPANESDSDSEPRCFPDPSLTSNGGGEICSAMNSF
KGLNLCEPITLEWCLNQPYNATGFPNALGHGTQASAAASWEAELLQALTHTACHPHMTFL
SCALLLPKCKPNSSHKILPCRSLCEEVRGSCERHLLNVGLSWPPEAECGRLSQWGPPDAC
LLPDASNADARCSPLLHFRCASGRCVSAARRCDSRSDCDDASDEQDCECAQRGMWECLSD
KSCINLDMHCDGFPDCRDEEDEKFCSQCEVEEMACLNHQCVPQRAWCDGERHCADGSDEW
DCELFSLNVNHNELLVHRHAQSRLVCSDGWGAALSHLACAQMGFWGEADTRFLQRAVRKK
FLPPLHLTPGWHQTNTSTVQAALAEGVPCDSESVVSVICHRNDVRADCGRRSSSPPPRRI
SKRILGGRVSREGRWPWQGSLRTALRPHSCGCTLIHRRWALTGAHCFTRQDDPEAWTAVF
GVNNLGHLSAFRQERKVRRIIRHERFSARTLDYDVALVELREEVWENPHVQPACLPHRGV
GVPDDTYCVITGWGVTSAKVVPSKLQEGEVRIISPSTCQGFFPLRPLTPRMLCAGYEAGS
VDSCMGDSGGPLVCEETDRRWTLYGLTSWGSVCSSKSVGPGVYTNVTQLLGWIERHIFLH
TFF
Download sequence
Identical sequences S4RCE1
ENSPMAP00000002873 ENSPMAP00000002873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]