SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000002935 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000002935
Domain Number 1 Region: 282-397
Classification Level Classification E-value
Superfamily PH domain-like 0.000000704
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000002935
Domain Number - Region: 1-51
Classification Level Classification E-value
Superfamily HR1 repeat 0.000889
Family HR1 repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000002935   Gene: ENSPMAG00000002689   Transcript: ENSPMAT00000002949
Sequence length 420
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476455:353804:364030:1 gene:ENSPMAG00000002689 transcript:ENSPMAT00000002949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREQLSREERVREGVCRLLSACTQREQTLHAAQALLACNARIQAFVEKLRRAQGAELVRR
ASLSAADDDNKERSTCKAKVCLSDIRIPLMWKDTDHFQNKGEFHRFAVFCLLKMDTEVFD
TKMITVDRTVTDILFDSVAVFPATEPGFELQLEVYSCCLLEDLSIASTPRRLASRLSSSV
GRSTGRRVLRQRSLSGPTDPYSSLGNTEQGYYTFPTRTPVFIHRAPKFHLLARVALTLEH
VYDGFRTHDLTITGKEGYSYWLPLYGNVCCRLVAQPACMTEDRMTGFLIVQDGDKQDCKL
FCVLIEGKLLCFATPQSRAKGQEPVFIMPVNKDTRMRLVGCEDGVDRLQVRNMESARWQS
HTLLAHRSPDLLAWLEALRQHVWDLDNWKQCCNKVMAIEELLPRAANLQSKPGSSLYYDM
Download sequence
Identical sequences S4RCK3
ENSPMAP00000002935 ENSPMAP00000002935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]