SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003044 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003044
Domain Number 1 Region: 242-395
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000542
Further Details:      
 
Domain Number 2 Region: 104-226
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-29
Family Spermadhesin, CUB domain 0.0000304
Further Details:      
 
Domain Number 3 Region: 398-567
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00012
Further Details:      
 
Domain Number 4 Region: 3-97
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-24
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003044   Gene: ENSPMAG00000002790   Transcript: ENSPMAT00000003059
Sequence length 569
Comment pep:novel scaffold:Pmarinus_7.0:GL476485:229541:264028:1 gene:ENSPMAG00000002790 transcript:ENSPMAT00000003059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEDYPPMQRCEWLLRAAGPGQRLALAFNPHFDIEKHDCRFDYVEVRDGEGDAAEAMGRFC
GSVAPAPIVSSGPALLIRFVSDYTNQGAGFSLRYEIHKSGSDACSRNLTGPVGVVSSPGF
PDKYPPFLACTYVIRAARGGVELSLRFTHFHLEGATRAPGAVEPALACQYDRLEVWDGLP
HVGLLVGRFCGTRSPGLVRSSTGILSLSFYTDAEVARDGFSASYTTSRRNVTRQDRHGEG
ACMRPLGMESGEILDEQISASPGFYAEQWRAEQTRLHRAGAACIHAPTESAREWLQVDLR
FVRLLGAVATQGALASNSTGVPCFVTAFRLEYSTSGSDWTVYRDVEKNKVIQGNRDDGGV
ALHRFAEAVVARYVRVKPVRWHGGLGLRLELYGCHISDAPCSEMLGLVSGEIGDRQLSAS
SSRDARWAPPLAPPAAGRSLLFLCQFYLNKFWLNVDLGTTRQVSGLLLQGAKIGPTKRRR
PPLRLPLETESKVFVRSFRLQLSLDGESWAGVQDPAGADKIFPGNSNADKPELRQINATL
ARFLRLFPEKWSTNGIGVRLEVLGCDAPG
Download sequence
Identical sequences S4RCW2
ENSPMAP00000003044 ENSPMAP00000003044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]