SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003047 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003047
Domain Number 1 Region: 83-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000315
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 2 Region: 149-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000598
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 3 Region: 19-69
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000834
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003047   Gene: ENSPMAG00000002797   Transcript: ENSPMAT00000003062
Sequence length 224
Comment pep:novel scaffold:Pmarinus_7.0:GL479271:66033:73329:1 gene:ENSPMAG00000002797 transcript:ENSPMAT00000003062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFALVMYKQLSMCCVSAQLCNLDIKIKGGDVILPRNPIPGSILHYVCPDGAYPYPVAWRV
CQRDGSWTPLLSDSREHSILASCNPMTCVQPLEFENGEFYPRKSVYKVGDKIQFSCYSGF
RVYGSSFLSCQSNGKWNGSLPICDDDEAFCHNPGIPFGSRKSGKDYNLEGVVTYTCPANL
IPSGTLKRVCLSNHQWSGKEPSCESRYSFDTAEDIEEALNNTML
Download sequence
Identical sequences S4RCW5
ENSPMAP00000003049 ENSPMAP00000003047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]