SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003114 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003114
Domain Number 1 Region: 3-217
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-39
Family Ankyrin repeat 0.00044
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000003114
Domain Number - Region: 227-276
Classification Level Classification E-value
Superfamily SOCS box-like 0.00262
Family SOCS box-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003114   Gene: ENSPMAG00000002859   Transcript: ENSPMAT00000003129
Sequence length 278
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477775:50348:57046:1 gene:ENSPMAG00000002859 transcript:ENSPMAT00000003129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVRDRNGWTLLHLATVRGSEGCVRLLLQHGVDPWDGDQEGGFTALHYAAMGGRGTVARIL
LQLDRRLGLVAARSRDGWTPLHVAASYGHEHVLRLLLNFGADVDAQNGKGLSALVLAVMR
ERESCVRALLERHADIRANHDLALFSAVLRGSDTICRLLLQVPRSXKNPTLTAQNSGGFV
AALRDDAACRLLHAHGAHAGTPNAAGVSPFSVCARRARSDSPCLQFLRQAACRPRSLLEC
SRAAVRRAAWRAGALPRLGELPLPPTLLRYVLFRGIDL
Download sequence
Identical sequences S4RD32
ENSPMAP00000003114 ENSPMAP00000003114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]