SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003166 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003166
Domain Number 1 Region: 141-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000103
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 600-636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000013
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 903-940
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 336-374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 668-705
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1261-1298
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1617-1653
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 408-445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 264-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 1108-1145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 1028-1064
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 528-564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 1657-1695
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 1546-1584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 15 Region: 1504-1542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 16 Region: 1462-1500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 17 Region: 1343-1381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 18 Region: 1301-1339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 19 Region: 1148-1186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 832-870
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 21 Region: 790-828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 22 Region: 1386-1422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000252
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 1699-1737
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000257
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 24 Region: 708-746
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000257
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 25 Region: 943-981
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000257
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 26 Region: 749-786
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 27 Region: 448-484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 1190-1228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 29 Region: 67-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 487-524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000332
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 1741-1779
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000345
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 32 Region: 563-598
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 33 Region: 1784-1820
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 1064-1098
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 35 Region: 985-1023
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000834
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 1422-1458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 37 Region: 175-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 38 Region: 24-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 873-901
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 40 Region: 1231-1259
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 41 Region: 110-138
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 42 Region: 378-406
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000367
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 43 Region: 212-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000615
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 44 Region: 642-666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000615
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 45 Region: 1588-1615
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000733
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000003166
Domain Number - Region: 310-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000108
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number - Region: 1-22
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003166   Gene: ENSPMAG00000002894   Transcript: ENSPMAT00000003181
Sequence length 1821
Comment pep:novel scaffold:Pmarinus_7.0:GL476689:240399:277283:-1 gene:ENSPMAG00000002894 transcript:ENSPMAT00000003181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIRGSLYCDGVTDCADQSDETPDCACREDQIRCRNGSCLGIEWIYVCDGEADCSGGSDES
DCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEHCADKKHCIRG
SLYCDGVTDCADQSDETPDCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESNCERGM
FECADKKHCIRGSLYCDGVTDCADQSDETPDCACRSDQIRCGNGSCLDKKHCIRGSLYCD
GVTDCADQSDETPDCACRSDQQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC
ERGMFEHHKKHCIRGSLYCDGVTDCADESDETPDCACRSDQIRCGNGSCLGWIYVCDGEA
DCSGGSDESDCERGMFEHCADKKHCIRGSLYCDGVTDCADQSDETPDCACRSDQIRCGNG
SCLGIASLCDGVNDCGDFTDESNCIQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSD
ESDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCTENQYACNNSNN
ECLEWIYVCDGEADCSGGSDESDCERGMFECADKKHCIRGSLYCDGVTDCADESDETPDC
ACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESNCERGADKKHCIRGSLYCDGVTDCAD
QSDETPDCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNS
NNECLEWIYVCDGEADCSGGSDESDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGG
SDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQGCTANQYA
CNNSNNECLEWIYVCDGEADCSGGSDESDCARECADKKHCIRGSLYCDGVTDCADQSDET
PDCACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECL
EWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDE
SDCAREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFECADKRHCIRG
SLYCDGVTDCADQSDETPDCACRSDQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSD
ESDCARVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQGCPANLYACN
NSNNECLEWIYVCDGEADCSGGSDESDCERGCADKKHCIRGSLYCDGVTDCADQSDETPD
CACRSDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEW
IYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESD
CEREGCPANLYACNNSNNECLEWIYVCDGEADCSGGSDESDCERDQYACNNSNNECLEWI
YVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDC
ERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNN
ECLEWIYVCDGEADCSGGSDESDCERGCADKKHCIRGSLYCDGLTDCADQSDETPDCACR
SDQIRCGNGSCLGWIYVCDGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVC
DGEADCSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERV
QGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESNCEREGCTANQYACNNSNNECLE
WIYVCDGEADCSGGSDESDCE
Download sequence
Identical sequences S4RD84
ENSPMAP00000003180 ENSPMAP00000003166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]