SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Petromyzon marinus 76_7.0 > ENSPMAP00000003180

Domain assignment for ENSPMAP00000003180 from Petromyzon marinus 76_7.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSPMAP00000003180
Domain Number 1 Region: 200-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 347-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 304-340
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 752-788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 914-952
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 425-463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 110-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000113
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 8 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 549-585
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 157-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 11 Region: 70-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 12 Region: 668-705
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000136
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 13 Region: 588-625
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 384-421
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 15 Region: 874-910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 16 Region: 628-665
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000168
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 17 Region: 791-828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 18 Region: 831-868
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 19 Region: 957-993
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 20 Region: 508-544
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000224
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 21 Region: 240-276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 22 Region: 470-498
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000995
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 23 Region: 1000-1028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000003180
Domain Number - Region: 2-24
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000223
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number - Region: 726-749
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00533
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003180   Gene: ENSPMAG00000002894   Transcript: ENSPMAT00000003195
Sequence length 1040
Comment pep:novel scaffold:Pmarinus_7.0:GL476689:250750:275904:-1 gene:ENSPMAG00000002894 transcript:ENSPMAT00000003195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
ECLEWIYVCDGEADCSGGSDESDCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGS
DESNCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERVQGCTANQYACN
NSNNECLEWIYVCDGEADCSGGSDESDCERGMFEHLQGCTANQYACNNSNNECLEWIYVC
DGEADCSGGSDESDCERDCACRSDQIRCGNGSCLGIASLCDGVNDCGDFTDESNCSNQGC
TENQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEQLCMPLRPNTLWQWELPG
NKGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESNCERGMFERCADQIRCGNGSCL
GWIYVCDGEADCSGGSDESDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESD
CERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEHCADKKHCIRG
SLYCDGVTDCADQSDETPDCACRSDQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSD
ESDCEREGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCARGCTANQYACNNSN
NECLEWIYVCDGEADCSGGSDESDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGGS
DESDCERGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCARGMFEHQIRCGNGS
CLGQGCTANQYACNNSNNECLEWIYVCDGEGCTANQYACNNSNNECLEWIYVCDGEADCS
GGSDESDCARGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGCPANLYACN
NSNNECLEWIYVCDGEADCSGGSDESDCERVQGCPANLYACNNSNNECLEWIYVCDGEAD
CSGGSDESDCERVQGCTANQYACNNSNNECLEWIYVCDGEADCSGGSDESDCEREGCTAN
QYACNNSNNECLEWIYVCDGEADCSGGSDESDCERGMFEHCADKKHCIRGSLYCDGVTDC
ADESDETPDCACRSDQGCPA
Download sequence
Identical sequences S4RD98
ENSPMAP00000003180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.