SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003349 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003349
Domain Number 1 Region: 76-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 391-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000737
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 137-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000813
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 4 Region: 196-266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 449-517
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 256-316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 501-560
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 15-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000021
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003349   Gene: ENSPMAG00000003078   Transcript: ENSPMAT00000003364
Sequence length 561
Comment pep:novel scaffold:Pmarinus_7.0:GL476462:338772:355022:-1 gene:ENSPMAG00000003078 transcript:ENSPMAT00000003364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLIMTASVVCTEGCGRPQKVAFASLSPQFIWRQWFFLQELVSYHCNIGYTVSGFSYSIR
CVEGGWTKHKFSCVLVTCKVLVEPENGFISVATEPVYGSVASYMCADGYSLVGPQLRRCM
QDGIWSDIDPVCEALSCPQPPDVANSAVVQMAQGTFSLGDSVMYACRDGFSISGEAHITC
LESGIWSKPPKCIDEDCGNPGSPRHGRLEGSSFTEGDSATFVCDIGYKIGGKDHINTTCD
SDGRWSRPLQDCELLSCGSPQPILNGRWTGNLTYGQVITYSCNEGVKFSDGIMVESTSIV
VCQANGLWLGRPPTCERKQTCAPPLPRTHSVASLPPVKTLGRQYPGSPRGTVASLPPVKT
SGRQQSETQKCPHTGLLGRFPRCVTTRLAKTCPALSAPRDGFIENDEVTVGTVVIFGCNK
GYKLAGKPTTECQPSLTWSSSIPSCQMVTCRAAPLEHGRVNVTAVTPFGSAAAYDCDLGF
VLVGQRVRVCLDTGEWSGSNPHCHRIKCKTPLELQHGEVVVDRENLNRVIYVCHEGLVLE
GPNVRMCTDAGTWSGTEPKCR
Download sequence
Identical sequences S4RDR7
ENSPMAP00000003349 ENSPMAP00000003349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]