SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003411 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003411
Domain Number 1 Region: 75-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000589
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 30-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000393
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 3-28
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000419
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003411   Gene: ENSPMAG00000003135   Transcript: ENSPMAT00000003426
Sequence length 339
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL488797:2264:6478:-1 gene:ENSPMAG00000003135 transcript:ENSPMAT00000003426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDGGCYDDSQRCDGHWDCVDGRDEAGCGQCPQEQFPCAKPSLGSGAGTSCYGRAERCNY
QTQCPDGSDERHCLSCQPGTWHCHNDRCIFESWVCDGQDDCGDGSDEKECPLVVPRRVIT
AATIGGLVCGLLLVIALGCSCKLYTLRSRQYRWFDSPLTRLDAELLCREPPPSYSQLIAQ
GLVPPVEDFPVHTHGQASVLESLRLAMRTQLGLSVAVGGAHSRHSHRRGRLWRRLRRLLR
GSSRSSRSGSSRRHHGAGSSGRGGDSGAGAGVGSGSRLQLLPSDDDDSDAECQDGAEVRG
ADAGPPGLSSPLGLLHKQPPTHFVEAANAGTAAAAAAVA
Download sequence
Identical sequences S4RDX9
ENSPMAP00000003411 ENSPMAP00000003411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]