SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003438 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003438
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 359-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 121-188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 244-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-17
Family Complement control module/SCR domain 0.00053
Further Details:      
 
Domain Number 5 Region: 419-488
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.77e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 61-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 176-236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 539-606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000688
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 301-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000778
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 10 Region: 471-533
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000389
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 11 Region: 598-656
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000778
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003438   Gene: ENSPMAG00000003157   Transcript: ENSPMAT00000003453
Sequence length 874
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476692:191866:231388:-1 gene:ENSPMAG00000003157 transcript:ENSPMAT00000003453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGHCGVLEPIVNGQVVGESYGYRDTVVYQCSPGFRLIGFSVRICQQDHNWSGNSPACVP
ISCGHPGSPVHGIAHGGRFNLDDVVGFSCDVGFVIHGPESTQCLPSGQWSDPLPVCKVVN
CTGPAHVENSYLEIKNKNKMFTYGTLVSYHCKPGYYLMGSSTLSCQPSGQWDKPPPVCTV
VNCSHPGLPPHGILAAEGFTYGSSVTYSCSERRALLGHPTRTCQASGHWSGSTPLCSGDG
HGACGDPGVPPHGSRRGGAFRTESVVSFSCDDGYVLRGSERRSCLANGSWSGTQPDCREF
QCALPFSDRDGSRPSWAGAVFPDSVTYACRDGFRMLGQRTRHCSANGTWSGSLPSCIVIT
CGDPGTPANAVRTGVDFTFGHNVTYRCHPGYTMEPTTQSQRVCTKEGVWSGNLPLCKIIR
CQEPPVVMHGRRESGDFTWGSAVAYGCLAGYQLSHSATLFCEGRGEWTGELPQCLPMFCG
DPGVPANGERQGRSFTFQSEVSFTCASPLVLVGSAKRVCMASGMWSGTQPRCIEASHTTC
TNPGTPHNGFQNFSLGYQVGSTVSFECKKGFHIQGSSTRTCLPDLTWNGLQPECVSHRCS
QPETPAYADVRAQDVAQLGYTLLYSCQPGYYLSGGSEHRTCDPEGAWSGKPPLCHATVPD
SIFAENHTWRGFYDYLGKKQPLSLSAPEFNLSSFRVNLTFSDRAVDLRLSGIYKRQEARL
TLHIFTITSQTQTSATKFKDENWVMDGYVSAEHGSYVYQGFIHAKGFGQFGVQRLGLTEP
GGWRESGVTRRGTSSSSVAIAILVPFFALIFAGFAFYLYKQRTRPKARFRSCTGHESSNG
QASFENTMYDTNARPGESKAVRFDPALNTVCTMV
Download sequence
Identical sequences S4RE06
ENSPMAP00000003438 ENSPMAP00000003438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]