SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003785 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003785
Domain Number 1 Region: 653-908
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-43
Family YWTD domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 27-100,236-497
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.39e-35
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 
Domain Number 3 Region: 1096-1135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000641
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 4 Region: 1006-1046
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 5 Region: 1191-1228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1146-1183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 969-1003
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1051-1081
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 1241-1274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000003785
Domain Number - Region: 569-621,900-944
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003785   Gene: ENSPMAG00000003463   Transcript: ENSPMAT00000003801
Sequence length 1274
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477925:4326:61385:1 gene:ENSPMAG00000003463 transcript:ENSPMAT00000003801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVHWAGEKSNVIVALARDSPLVQKEPSSAVYVSYDYGHSYKNIQTNFSRLPNGSETVIA
QFYHSPVDNRRYIFTDTLHSYLWITNDFGQTVKNFSCPFRPTDLLLHNKNPNLVLGYDSS
HANCTANPPHRGGCGGAYVNVQVCHHGWGSLYALPHEIGIQDLFFLHKFFLIFKNVFFSS
ASFSFGSQTILSYGVDDFQLRDSYMFATKTVVRAPPRTSRWLAYTYGQSQNTAFGISAGA
HEYYIADASEDQVFVCVNHEGGLTNLYISEREGLKFSLSLERVLYFSPKGPGADTLVRYF
AQEPFADIHRVEGLRGIYIATQVSGEHFSEENMRSFITFDKGGEWQPLLPPDTDSWGRPV
NCQLKDNCSLHVTQKYSQLLNFRDRLLPVMSKISAPGLIMASGSVGKNLAHKPNVYISST
AGAHWRETLVGPHYFAWGDHGGILVAVSQEGLTGMLKFSTDEGQTWRDFQFSTENITVYG
LMTEPGEKSAVFTIFGSKAPAAHSWLILQINMTYVLGSACLDEDYKLWSPADELGNECLL
GRKTVYKRRTAHALCFNGEDFDRPIMSSNCSCTREDFECDTGFKLTLENEQCVQDTDFDG
DPYAPPVNCPAGTMYRQTKGYRKVSGDTCSGGDMEGVLDGNIVPCPVMEEREFVLYARRT
SIHRYDLATGLDETLPLTGLHSAVALDFDYLRNCLYWADIAFDTIQTFNSNHVNKRVQLR
KCEGLKNVEGVVVDPNSNLLYWVDAEARHIEVSRLDGTYRKVILNSTVLEKPRGLVLVPN
KGIMFWTDWGEVNAGIGSSDMDGQHSNKIVNSNVRWPNGIAIDGETIYWTDAFYDRIERA
SLDGSNRVVLINSNLPHPYAIAVYKSDVYWDDWSRMGIMRANKYDGSGVQTLVNRAPGIM
DMKIFYSGKQNSAYRTDKNGGCSHLCLPKPNGRTCQCPDGMSSVQQSSGDFICNSRDPPV
SDVRCGPELVCAESQFKCANGRCINILWKCDHDEDDCGDNSDEPADCPHQKCQATEFSCS
NGRCVRSAWRCDGDNDCHDWSDEVNCSSSQGMECCPSGPCIPRRWLCDGDKDCLDGADEQ
QQCGTRPPAMWCSMLHQPINCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCREMPS
PEVVCCTVMIGEFRCGDGTCIFDHFVCDGSPDCADGSDEYGCPTQHGRPSPCSFTQFQCL
KDKTCVPASARCDGRKDCVDGSDELGCYDSGSQLCYSMPGVCGENQFACVDGSGCLEHFM
LCDGYHDCQDRSDE
Download sequence
Identical sequences S4RF03
ENSPMAP00000003789 ENSPMAP00000003785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]