SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000003797 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000003797
Domain Number 1 Region: 343-597
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-45
Family YWTD domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 7-187
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 3.14e-28
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 
Domain Number 3 Region: 791-828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000864
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 4 Region: 889-927
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000105
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 5 Region: 695-735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 6 Region: 742-777
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 7 Region: 845-882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 658-692
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 934-969
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000003797   Gene: ENSPMAG00000003463   Transcript: ENSPMAT00000003813
Sequence length 969
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL477925:35705:59671:1 gene:ENSPMAG00000003463 transcript:ENSPMAT00000003813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGLRGIYIATQVSGEHFSEENMRSFITFDKGGEWQPLLPPDTDSWGRPVNCQLKDNCSL
HVTQKYSQLLNFRDRLLPVMSKISAPGLIMASGSVGKNLAHKPNVYISSTAGAHWRETLV
GPHYFAWGDHGGILVAVSQEGLTGMLKFSTDEGQTWRDFQFSTENITVYGLMTEPGEKSA
VFTIFGSKAPAAHSWLILQINMTYVLGSACLDEDYKLWSPADELGNECLLGRKTVYKRRT
AHALCFNGEDFDRPIMSSNCSCTREDFECDTGFKLTLENEQCVQDTDFDGDPYAPPVNCP
AGTMYRQTKGYRKVSGDTCSGGDMEGVLDGNIVPCPVMEEREFVLYARRTSIHRYDLATG
LDETLPLTGLHSAVALDFDYLRNCLYWADIAFDTIQRLCLNGTLGQQQLLKEGLKNVEGV
VVDPNSNLLYWVDAEARHIEVSRLDGTYRKVILNSTVLEKPRGLVLVPNKGIMFWTDWGE
VNAGIGSSDMDGQHSNKIVNSNVRWPNGIAIDGETIYWTDAFYDRIERASLDGSNRVVLI
NSNLPHPYAIAVYKSDVYWDDWSRMGIMRANKYDGSGVQTLVNRAPGIMDMKIFYSGKQN
SAYRTAHNISCKSSSKVFFLTINVYIFFKCGNSIFEPHENIMCPFFLFFKGGLCRALGTC
GTNQFRCQNSGRCIPMSYKCDQEDDCGDNSDEPADCPHQKCQATEFSCSNGRCVRSAWRC
DGDNDCHDWSDEVNCSSSQGNISCSADGFQCPSGPCIPRRWLCDGDKDCLDGADEQQQCG
GLVPPQPTPGHLNCTSSEFQCRSGVCISLHWKCDGVDDCGDYSDEANCRASCIICWSSGP
TVAPRCLPLFQFQCRNHRCVPVWWKCDNDNDCGDWSDEDTCPSKLPSGCPAHQFRCGDGT
CIFDHFVCDGSPDCADGSDEYGCPTQHAVITGRPSPCSFTQFQCLKDKTCVPASARCDGR
KDCVDGSDE
Download sequence
Identical sequences S4RF15
ENSPMAP00000003797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]