SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000004159 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000004159
Domain Number 1 Region: 3161-3427
Classification Level Classification E-value
Superfamily YWTD domain 9.42e-50
Family YWTD domain 0.00000169
Further Details:      
 
Domain Number 2 Region: 2351-2604
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-45
Family YWTD domain 0.00000678
Further Details:      
 
Domain Number 3 Region: 1405-1663
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-44
Family YWTD domain 0.0000052
Further Details:      
 
Domain Number 4 Region: 368-631
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-43
Family YWTD domain 0.00000798
Further Details:      
 
Domain Number 5 Region: 684-946
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-42
Family YWTD domain 0.0000184
Further Details:      
 
Domain Number 6 Region: 1710-1961
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-38
Family YWTD domain 0.0000624
Further Details:      
 
Domain Number 7 Region: 2026-2297
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-36
Family YWTD domain 0.0000896
Further Details:      
 
Domain Number 8 Region: 4021-4281
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-35
Family YWTD domain 0.0000197
Further Details:      
 
Domain Number 9 Region: 1301-1391,1663-1707
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 238-254,289-357,632-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000643
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 11 Region: 3592-3636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000406
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 12 Region: 189-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 13 Region: 2866-2901
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 14 Region: 1228-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 15 Region: 2947-2990
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 16 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000838
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 17 Region: 2988-3030
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000916
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 18 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 3718-3758
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 1067-1105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 21 Region: 3554-3595
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 22 Region: 3106-3154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000385
Family EGF-type module 0.008
Further Details:      
 
Domain Number 23 Region: 3805-3841
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 24 Region: 2695-2736
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 1001-1037
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 26 Region: 3761-3798
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 27 Region: 3031-3071
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 28 Region: 3683-3719
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 29 Region: 3891-3927
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 30 Region: 3512-3554
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 2825-2858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 32 Region: 73-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 33 Region: 1109-1146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 2659-2697
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 35 Region: 1191-1226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.00061
Further Details:      
 
Domain Number 36 Region: 3476-3510
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000089
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 37 Region: 1148-1186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 38 Region: 38-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 39 Region: 3073-3118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000604
Family EGF-type module 0.02
Further Details:      
 
Domain Number 40 Region: 3847-3884
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 41 Region: 1981-2027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000128
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 42 Region: 3646-3679
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 43 Region: 120-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 44 Region: 2904-2947
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000123
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 45 Region: 2611-2675,2708-2798
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000706
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 46 Region: 1272-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000812
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 47 Region: 3972-4004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.011
Further Details:      
 
Domain Number 48 Region: 4347-4380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000023
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000004159
Domain Number - Region: 2303-2351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000102
Family EGF-type module 0.0077
Further Details:      
 
Domain Number - Region: 956-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000122
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 3934-3972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000139
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 3432-3463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0352
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 1041-1062
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0903
Family LDL receptor-like module 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000004159   Gene: ENSPMAG00000003658   Transcript: ENSPMAT00000004176
Sequence length 4573
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL501029:133054:203238:1 gene:ENSPMAG00000003658 transcript:ENSPMAT00000004176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARAFVC
DGEADCADRSDEHQNCPGSTCSSSHFTCASGHCVQSAFRCDHFQDCDDRSDEQSCQYPTC
AEMTCANGACFNTAQRCDGVVNCRDLSDEANCTARCPVGEFQCANERCVPQSYRCDHIDD
CTDGSDENGCVYGTCQGNQFTCASGRCILQSWVCDGDDDCFDGSDERGCVSAASEERECY
PEEWPCPGSKACIPFRKVCDGRRDCPHGTDESNSTAGLACSIENCGALSCEYRCHASPAG
GACYCPPSFVVSNNSITCMDFDDCKMWGVCDQFCENRPAGHMCQCSPGYLLEYGKHCRAD
VTSGVASLLFSNGKDLVMSDLQGRTVRVLVPSQNRGVAVGVDYHYILRRVFWTDTMQNKV
LSVNMDTLAVETVLSVALDMPENLAVDWISNKLYIVESSVDRIDVTDLNGANRLTLIAEN
LGRPRGIALDPTVGKGSIFFSDWDDASGNPRLERAYMDGTNRLALVRTKLGWPAGITLDF
VLQRVFWVDNRFDYIESVTYDGLIRKTILSGGANVPHPFDITTFEHYVYFTDWTRMEVTR
VNVFNGSDLQVVHRSNIQPYGVIVHHSLRQPQVRNPCGPNNGGCEQICVLSHRTDNVGLG
YRCKCRVGFDLQPDGLRCFPVTKFLLFSAMTSVRGIPLNQSQQEDVILPVMGSPVTFVGI
DFDAASQRVIVSDTSQGKIFQQNLDGTGRVNLTSRDVSSVESLAYDWVSKNLYWTDTRNR
AVTVMRLIDQSRRNILSNLQNPRSIVVHPLQGYIFYSDWNRPAKIVRAWCDGSHATPIVN
TSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISHLAHPFSISIHG
GFAYFSDWRLNSIVRVQKMDGGEAVIIRQGIQYLMNVKVYDTDIQTGSNACNRPANPNGD
CSHFCFPAPSGARVCGCPYGKRLAEDGRMCADNPLEPPTPQCSSTEFFACANGRCVPRLF
LCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASG
NRCIPRYWICDTDNDCGDGSDERGCDMSGTCHPMQFQCPDHRCIDNAYVCDGDSDCVDGA
DERGCVFNCTSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCPTRAPGLCHNDEFQCQ
SDGLCIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYLRCDNGNCVPESWRCDGDNDCRD
GTDERDCPTPPYRCQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDESPHCNEHDCSVNN
GGCSHGCVQGPFGAQCTCPPGFQLLDDTKNCADVDECDPPGSCSQQCVNEHGSFRCHCDL
GYTMESDRRTCKANDRHEVLLLVPSRSQIYSDNITATPNVLSSVVRNGRSIVAVDFDARA
GRIYWADVAEDKIWSALRNGTDRQLVHKQVGLTVTENLAVDWIGKNLYWLDFVLETIEVS
RLDGSHRTVLISTNVTNPRGLVLDPRDGSRTMFWTDWGKNPRIERAGMDGRLRRTIVSSK
LYWPNGLAIDYATNLLYFADAYLDFIDFCDFNGQNRRQVLASDLILQHPHAITIFEDFVY
WTDRSTNRVMRANKWHGGNQSTMIYNLQQPMGLVASHSVRQPTATNPCLGQSCSHLCLLS
PITPFFYSCACPSGWNLGPDGRTCQKEDRPFLIVVRSSIIFGISLDPNQTSNDAMVPISG
ISNGYDVDFDDTQFIYWVENPGSIHRVKTDGTNRTQFAPSAILGAPSGLAIDWISRNLYY
TNPRSQTIEVIKMDGVQNYRKTIIGNNGQTTGVGYPVGIALDPSRGRLYWTDHGSDSGVP
AKVAAADMDGSNPTVLFSGNMDHVDFITLDMREQKLYWAVAGTGVIERGDVTGLNRITVV
QHLSHPWGVAVHESHLYYTDYDYEVVERVGKDGSTPVLMRSNIPGLKCLKVHFRDTSSGT
TNACSSGNGGCQQLCLPRPNAQRACGCSTGFQLAPDQISCRLYESFVIVSQLSAIRGFHI
NSTDHSEAMVPVAGTGRNALHVDVHMPSGFLYWCDHGSASTYRGIRRIKPDGSGFQTVVS
SGIGPSGVAGIAVDWVAGNLYFTNVFSSETHLEVQRLDTSFRRVLFKTSVDRPRHLAVDP
RARFLFWVDAGQRPKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYWADDGLDRIG
RLAPDGSTWQVVREGRGYPAPYGLAIYGSNLIWVDRNLRKVLQASKEPQASPPPPEVIRD
NLGTLRDVTIFDPRVQPTAPELINFNPCRLNNGGCQQFCFALPSVTTATCACAHGELGSD
RVSCVMPSDEYLMFVTEDSIRSMRLDPEDHSLPIPTAQVSRVAVALDFDIADGRVYFTQS
MGLARSRISFFSLSSPSSVTVIASDLGSPDGIAFDWINRRIYYSDYANQTIGSMGLDGGN
RTVVALVPRPRAIMLDPCKGYMYWTDWSVNAKIERATLGGNFRVPIINSSLVWPNGLTLD
YSENMLYWADAYRQKIERSTLTGDRREVIVSMAVYPFALTIHEQHVYWTDWNTKSVYRAT
KDDGADQVVMIQNLPYRPMDIHILTASKQQRCSNPCNQFNGGCSHICVPGPSGVECQCPA
QGRWYLANGGKDCINDSGQQCGTSQFTCLNGRCIPFRNKCDNRDNCRDGSDELERVCAFH
TCEPTDFTCRNGRCVRYGYRCDHTNDCGDSSDEEGCAFRTCDPAAEFACTNGRCIARSQV
CNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPL
PLHTCFIANEFRCGNGQCIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTCDSGRC
IPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADC
SDALDEHQNCTRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFT
CENGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSPTCAPGFFRCGAGECVAIHLVCNQAN
DCADGSDEKGCGINECLYASINQCAHNCTNTLTSFYCSCWAGFRLMANGRACEDIDECNE
TPQVCSQLCENTAGSYFCKCAPGYVRLPNGRTCRQNSGVEPYLIFSNRYYVRNMTVGGRS
YTPILQNLTNAVALDFDRVERRLYWVDYGQRTIERMFLNRTGLETVMKHDLPAPEGLAID
WVGRKMYWADAVLDCLNVAELDGRYRKKLLSGCVDTNHTYCLENPRGVTLHPRFGRVLYW
TDWGNTPYIARVGMDGKNNKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLDG
SHRHTTLAGSLPHVFALTVFEDTIFWTDWNTRSIESAHKYTGEGRTMLANTTHRPFDIHV
YHPYRQPPEVPNPCGSNNGGCSHLCLVAAGGTGFQCECPDDFAAIHVGTTVRCLARCTST
QFRCQDDERCIPIWWKCDGQRDCRDASDEPATCPHRYCPIGRFQCRDGNCTSSNLLCNGN
NNCPDGSDEEDTLCFNHRCNSNQWQCMNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTC
APGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPT
WAVCNGMDDCRDNSDEQGCAEITCDPLGDYRCDNHRCIPLRWRCDRYDDCGDGSDERNCA
PRPCSESEFRCTNQRCIPGRWVCNHENDCGDNSDERDCELQTCLPGYFQCGSGHCIPERL
KCDGSADCQDFSDESLCPTRYPNGTWCPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEEL
HHCLDTPCNPPGRFRCDNNRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCTEEEFKC
ASGRCIPMAAVCNNYNECRDNTDETGCNQGQDRTCAERICEQNCTNLPGNGFICSCRPGF
TANAENRNNCDDVNECEVFGTCPQDCQNAKGTYECFCVDGYRSAAGSYGKRCIANDNSPV
LLLADKVRVRKYDLTSQKQADYISNEEDIQALDFDWDHDGTGLSMVYYTVLRSGGKFGSI
KRAYLAAFSNSSENFATGINLGLRYISQPDGIAVDWVGRHIYWTDAQTSRIEVALLDGRY
RKQLINSVLDKPATIALNPKLGMMYWTDWGVVPKIEMAWMDGQQRQHLVQGLLGWPTGLA
VDHTNNGRIYWCDAKENVIESVRPDGGDRRTVISGDLGNPFTLDVFESNVYWTTRETGQV
WQQNKFGSGVKSHILTVNSWLSQARVFQKHRYNVNVKNPCKGTCSHLCLLRPQGYTCACP
QNAQFIPGSETECDAAIVPPPTMPPACFCVNGGTCYFSSDGNAHCRCLSGYIGNYCEMST
FIGIISSSVVAVIVIMVVIGLIGGLLAFAHFNYKHKGLPLPLPNLTSIVSMFKSQKASAP
ESERGRDVYVNIERPGMNTDAAIDAALEMDKNMVDRGRPPVNFENPLYGAHVDAEMRISK
LPKEMVSSGEMEGAAASESPGFASEALSAADAAASQEKKRFSFFGKKEKTENNFENPLYS
QKQSDHEGNTGDI
Download sequence
Identical sequences S4RG27
ENSPMAP00000004159 ENSPMAP00000004159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]