SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000004265 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000004265
Domain Number 1 Region: 69-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 2 Region: 5-70
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000118
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000004265   Gene: ENSPMAG00000003917   Transcript: ENSPMAT00000004282
Sequence length 234
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL478188:25:2079:1 gene:ENSPMAG00000003917 transcript:ENSPMAT00000004282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSPIECNRNFVAVYDGSSAIENLRAQFCSTVASDLMLRSGVGVVRLWADNCSRLSRFRM
LYTSFLDPPCDRNSFFCHSNMCINSSLVCNGVQNCAYPWDENHCKAERKKPSFWQHITKT
NGTMIGMSTALVLVLLALSVYVQLTQPRKKLTARRVSSSVRDTSCASPTAGAASPSIAAT
ATYDPFPLGDKETYVDLSDLPDDFQPLSGMRRSSSTALSRCVREHHCGGLATST
Download sequence
Identical sequences S4RGD3
ENSPMAP00000004265 ENSPMAP00000004265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]