SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000004816 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000004816
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily HR1 repeat 4.45e-20
Family HR1 repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000004816
Domain Number - Region: 52-135
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000004816   Gene: ENSPMAG00000004381   Transcript: ENSPMAT00000004835
Sequence length 344
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL480606:4394:25584:1 gene:ENSPMAG00000004381 transcript:ENSPMAT00000004835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCDPFAQTQRSKLQTRRAKLNQQINKEMRLRAGAENLLRATNNNKVKETVALELSFVNSN
LQLLKEELAELNSSMEIYQNDSEGISVPLIPLGLKETKEVDFLTPFKAFIEEHYGECGEK
YEEEIKDLLELRQAMRTPRRNEVGVELLMEYYNQLYFVENRFCPPHRHSGVFFTWYDSLT
GMPACQRTLAFERGSVLFNVGALYTQIGARQDRTAHDGLHSAIDAFQKAAGAFNYLKENF
THAPTLDMSPASLTMLVRLMAAQVQECVFERFLLQGLHNDVPALFNIAQEATRVSDVYNV
THQTMDQTAITDYVPVSWRTMVRVKSLHFLALSHHYVALALLEH
Download sequence
Identical sequences S4RHY4
ENSPMAP00000004816 ENSPMAP00000004816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]