SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000004910 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000004910
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-51
Family SPRY domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000004910   Gene: ENSPMAG00000004476   Transcript: ENSPMAT00000004929
Sequence length 165
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL501192:25493:27165:1 gene:ENSPMAG00000004476 transcript:ENSPMAT00000004929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRQSLFVYNGCSPTLDTNSAHNELQISSDLRTVTWSGVSQGRPHHPQRFEVYRQALCSES
FSSGQHYWEVDVGSSAWEYLLGGSDVSWSLQKYNNSLSVWHGGVETLLSVPEPPQRVGVH
LDWDAGLLSFYSIDSMVLLHSFYQTFTQPLYPGLYLYSRKSINCL
Download sequence
Identical sequences S4RI78
ENSPMAP00000004908 ENSPMAP00000004910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]