SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005004 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPMAP00000005004
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily HR1 repeat 0.00811
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005004   Gene: ENSPMAG00000004567   Transcript: ENSPMAT00000005023
Sequence length 270
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL481849:7823:15018:1 gene:ENSPMAG00000004567 transcript:ENSPMAT00000005023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDAGLQARIEREMRVREGACRLLAACSRAEQALDAARSLLVCDARVLACMAELQRRQEAQ
VLRRAQRRSSDGGPQERVSCTGTVAITDIRIPLMWKDTQHFKNKGGVAESPRHAVFCLLR
LGSEIVDTEMVLVDRSVTDVCFEAPAVFREASPAFRLRVEVYSCCAAEESCRVGGGAAGT
QVGPRGLAGRISGSLGRSAGRRARAALDTSPRGDAGASGTAAATSPPVTTVSSVSLSGPK
YQLLAHTSLTLDDVQDGFRTHDLTITATGE
Download sequence
Identical sequences S4RIH2
ENSPMAP00000005004 ENSPMAP00000005004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]