SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005047 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005047
Domain Number 1 Region: 6-228
Classification Level Classification E-value
Superfamily L domain-like 5.29e-55
Family Ngr ectodomain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005047   Gene: ENSPMAG00000004069   Transcript: ENSPMAT00000005066
Sequence length 229
Comment pep:novel scaffold:Pmarinus_7.0:GL476584:229611:317338:-1 gene:ENSPMAG00000004069 transcript:ENSPMAT00000005066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARPSQCSCSGTSVDCRSRRHASVPAGIPTTTQYLYLLVNQITKLEPGVFHSLAALVETRL
RSEELASLPTGVFDKLTQLTRLELQTNQLKGVPRGLFDRLVNLQQLYLGGNQLSALPDGV
LDSLTQLTYLTLRNNQLTALPEGVFDRLVNLQQLYLHLNRLSSIPAGMFDKLTNLKELKL
YSNQLKSIPRGAFDNLKSLTHIWLLNNPWDCACTDIMYLSTWIGQNSGK
Download sequence
Identical sequences S4RIL5
ENSPMAP00000005047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]