SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005326 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005326
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-22
Family Ankyrin repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 221-266
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000706
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005326   Gene: ENSPMAG00000004872   Transcript: ENSPMAT00000005346
Sequence length 271
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL484815:4673:8137:-1 gene:ENSPMAG00000004872 transcript:ENSPMAT00000005346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVRARACAGADVNLETGNAAEEMPLHTAARCGLPEHTALYVSHGAEVDGSDGHDETPLCT
AIFWALSMRNMCVSPQHHKVCERLLTLGADPNGVDTDRKSALHRAAWNADCTLLELLLSA
GAHVNQLDGLGCTALQYIVRVVSVRPTLQPERCIQMLNHGSVSIYPLQFHKVLELCGNSP
AAVEILVNSYKQLRITHAWAPALSQDAREAHRDFYASLLHFCNGVPRSLLHLSRCAIRGV
LGERCHCQIPRLPLPARLRDYLLLNPEGIIY
Download sequence
Identical sequences S4RJE4
ENSPMAP00000005326 ENSPMAP00000005326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]