SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005415 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005415
Domain Number 1 Region: 239-347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 62-125,179-233
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000175
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005415   Gene: ENSPMAG00000004944   Transcript: ENSPMAT00000005435
Sequence length 375
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476588:444965:457494:-1 gene:ENSPMAG00000004944 transcript:ENSPMAT00000005435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKKTDKKLRKTIRALKKSINKEQFVVRFSGTDYEVTRKAPKKSERQGPCSAGQVPTDGKC
ATAVSCRPGTFYSGAQEKCLSCSPGTYQDKEGQLACEPCPGTDVKGLLGVLGARNISECA
GACRPPHPHLAVPSPLYAHRRGQPCNRSLALPAAVTVAKYARRQSVNRASTCAVAPTVHC
SPGHYYDSGTHRCVRCPIGTYQPEFGQNFCVGCPGNTTTDFDGSTNVTQCKNTLCGGELG
EFTGFIESPNYPGDYPSNVECTWNISPPQNRRILIVVPEIFLPIDDECGDYLVMRKTASP
YSVTTYETCQTYERPIAFTSRSRRLWVQFKSNEGNSAKGFQVHYVTYDEDYQELIEDIVR
DGRLYASENHQEILK
Download sequence
Identical sequences S4RJN2
ENSPMAP00000005415 ENSPMAP00000005415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]