SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005428 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005428
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-16
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005428   Gene: ENSPMAG00000004961   Transcript: ENSPMAT00000005448
Sequence length 206
Comment pep:novel scaffold:Pmarinus_7.0:GL486810:5612:9383:-1 gene:ENSPMAG00000004961 transcript:ENSPMAT00000005448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCGGDLGDLVGELESPNHPGSYPVPASCQWLVTAPARHRLLLLLPEAELRPCDVACTDRL
SVKASPAVSPQGRVWLELCSSRARPLLLNVPARRVWVDFSSSSSGSTGIAAAEAEGATAA
GFHMDYVAYHEEYEDLIQDIISDGHLYSFESHQQVLKNKKLVKTLFEVLANPHSYFKSTS
QHAKNLFPKSFLRFLKSKISRYLHPL
Download sequence
Identical sequences S4RJP5
ENSPMAP00000005428 ENSPMAP00000005428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]