SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005544 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005544
Domain Number 1 Region: 52-149
Classification Level Classification E-value
Superfamily LCCL domain 1.23e-27
Family LCCL domain 0.002
Further Details:      
 
Domain Number 2 Region: 154-255
Classification Level Classification E-value
Superfamily LCCL domain 4.05e-26
Family LCCL domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005544   Gene: ENSPMAG00000005060   Transcript: ENSPMAT00000005565
Sequence length 260
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476410:1117984:1137906:1 gene:ENSPMAG00000005060 transcript:ENSPMAT00000005565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTDGSYSPEEPEEEETNRVDYVQRPERRRRPRPRPTRPPSRGRMVTSHDKMSQLVSCDTK
FRDKCKGSTCNRYECPPSCLQGSGKVFGTLFYEVSSSICRAALHYGILDDEGGWVDITRQ
GRKPFFIKSQRNGVQALSKHKASNAFSFSAVSVKSVDCSATVAQLCPYKKSSPHCPRMYC
RPGCVNADSDVYGSKVYADNSSICRAAIHAGVITNAQGGYVDVMPVDKKNHYGSTHQNGI
LSKRTRNPAGGKAFRLFVVG
Download sequence
Identical sequences S4RK11
ENSPMAP00000005544 ENSPMAP00000005544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]