SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000005713 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000005713
Domain Number 1 Region: 13-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 253-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 3 Region: 127-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000034
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000005713   Gene: ENSPMAG00000005204   Transcript: ENSPMAT00000005738
Sequence length 293
Comment pep:novel scaffold:Pmarinus_7.0:GL476535:39219:52768:1 gene:ENSPMAG00000005204 transcript:ENSPMAT00000005738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAQCGTWLRNPNGGSFSSSNYPGNYPPDKECIYILEAPPRQRTELHFDEPYSVEPSWECK
FDHLEVRDGPFSFSPLIGRFCGTERPPPITSNGRFMWIKFYSDGELESMGFRAYYTFLPD
PDFSHMGTCEFEVSGAEGILKSAQLETESKATANEAIDCFWTIRATPNSRVLSHPQPQES
ASSDCKQYLCPNFRESLYGGLLSLSLCDYMLCMAVSIQSFVNTGVSLIDRVWCSQAGWVN
GYKLSYEFFCRAPCDGSMFFCHSNMCINSSLVCNGVQNCVYPWDEKHCKEKRK
Download sequence
Identical sequences S4RKI0
ENSPMAP00000005713 ENSPMAP00000005713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]