SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006314 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006314
Domain Number 1 Region: 318-518
Classification Level Classification E-value
Superfamily Kelch motif 2.75e-31
Family Kelch motif 0.0058
Further Details:      
 
Domain Number 2 Region: 624-796
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-21
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 2-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.24e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 201-317
Classification Level Classification E-value
Superfamily Kelch motif 9.94e-20
Family Kelch motif 0.015
Further Details:      
 
Domain Number 5 Region: 934-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000006314
Domain Number - Region: 103-182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00188
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006314   Gene: ENSPMAG00000005626   Transcript: ENSPMAT00000006343
Sequence length 1291
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479340:380:38146:1 gene:ENSPMAG00000005626 transcript:ENSPMAT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTEPSGMITDGPNKYKYKTKCTWLIEGFPNAVLRLRFNHFATECSWDHMYVYDGDSIYS
PLLAAFSGLIVPEARRNETVPEVVATSGFVFLHFFSDAAYNLTGFNISYSMNSCPNNCSG
HGRCVAYGPQRRVTCQCERGWKGEACDFPYCNKDCGAPHRGHCERQHQRGCVCQPGWQGP
DCSLEDPSEEAYWLMPDVTPPRPLPRRASHKAVVLGDYMWVVGGYTFNYTAFHMVTRYNL
RKHMWDPLPDRKTGPSQRYGHSLASHQSGIYMYGGRVEASSGNVSSELWWLDVATLAWTR
LVPQVAPGPRRQQFAVVGHSAHIVPLGAGTSVMLVFFGHCPTHGYVNFVQEYNLNSGSWR
ILECSGARVQGMYGHSSAFDPSTHAIYIHGGYKAFSPNKYGLVDDLYKYNVDTRTWTVLK
DSGFFRFLHSSVVIGGTVLLFGGNAHNDTSMSNGARCFSADFLAYDIASDEWTVLPKPNL
HRDVNRFGHSAVVSNGSMYIFGGFNSLMLGDVLEYRPPGCGARRSQHACLSTHPGVRCLW
LQERCVSWEEGYASAPPEQLYRINHTRPSLDDERCDKYTDCASCTSNTNGCLWCEDQCIS
DSSNCTEGEAVMNLTECVPSTEEVCNKLTSCTTCLLESNCQWDAKEQECTTIAAHLCGER
WMRVGGQCLRVLPEAVSNDNAKLQCYNEHAALASLTSQRHVDFLLASLRRDHPQVLPAGS
VLRLELTPWVGLRKINVSYWSWDDMSPFANSSLQWLPREPSDSGFCAYLDQSTIAGLRAH
PCTSKVFGAVCQKTLVHPTLSSLRCRPPCALRRTCGECTSSGSECMWCSNAKRCVESHAY
VPSFPYGQCMEWNTANTCPPESCAGHRTCSRCLDEPGCGWCNDASRTGRGLCLEGSSRGP
LRLGSAPGADSAVDPALCRADHGHEWAFIQCPPCQCNGHSDCVNGSLCESCQELTTGKHC
ETCIVGYYGDATNGGKCQECFCNGHATNCNPLTGKCFCTTKGIRGDQCEVCETENRYLGN
SLKGTCYYNLMVDYQFTFSLSLEEDSHYTAINFKANPDEQNRDMDMFINASKSFNLNITW
SSRSSGGTESGEEVVVVSLFNIKEYEDSFSDEQYDFEDNPNITFYVYVSNFTAPISIQIS
FSQRSNFMDLVQFFVTFFSCFLSLLLLAAVVWKIKHSCWASHRREMLVREKQQMGSRPVA
SVSLVLPLREEPFLTFTEPFPMLPKPIALQPCTDNRATIVSIAIMLPHGLNNAPPPGQSG
LAVGSALIDLLHQRAAEGREKAPAARSRKHQ
Download sequence
Identical sequences S4RM78
ENSPMAP00000006314 ENSPMAP00000006314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]