SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006411 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006411
Domain Number 1 Region: 11-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 127-227
Classification Level Classification E-value
Superfamily LCCL domain 8.37e-22
Family LCCL domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006411   Gene: ENSPMAG00000005818   Transcript: ENSPMAT00000006440
Sequence length 231
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL483409:1219:9493:-1 gene:ENSPMAG00000005818 transcript:ENSPMAT00000006440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSPRSSPGSACGLTVLGPASGTLASLDYPQAYPRNGSCRWLVRGPPGSRLRLRFADFLVP
YNEHCQADYVRLFDGERASSELGRYCGNMYYVPKEVVSVGSEVTVEFQSRSGTTGRGFLL
NYATEQHADLITCLSLGSHFSDEALEYRKYCPAGCFSTDSEIMGCPETGYRDSSPLCRAA
VHAGVLAADQGGSVTVRRASGAHYYKGTRANGIASTDGPLSDWLFKFKTDG
Download sequence
Identical sequences S4RMH5
ENSPMAP00000006411 ENSPMAP00000006411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]