SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006466 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006466
Domain Number 1 Region: 97-217
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-35
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 2 Region: 274-382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 215-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 387-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 41-106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000006466
Domain Number - Region: 5-35
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000144
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006466   Gene: ENSPMAG00000005870   Transcript: ENSPMAT00000006495
Sequence length 444
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479301:959:30909:1 gene:ENSPMAG00000005870 transcript:ENSPMAT00000006495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GETLPLSSGNQITLTFTSSHDASGKGFHFVYQAVPRTSSDQCSSVPEPKFGQRLGNSFSV
DSVLRFECNSGYILQGARAIQCQKVPNSLAQWNESYPTCVVPCGGNLTELKGAILTPGFP
EPYDNNLNCVWKITVPEGAGVKMHVFSFATEQNWDALEIYDGGDANSPRLGSFSGTSIPA
VLNSTSNSLYLHFHSDISVSAAGFHIEYTAVGLASCPEPELPTNGVKVGDRYLVNDVVMF
QCEQGYTLQGPTHATCMPGPVRRWNFPPPLCIAQCGGVLTELTGVILSPGFPGNYPSNLD
CTWKVLLPMGYGAYFAFVNFSTEPLHDFVEILSGPPEAQEAIGRFSGARPPAPALSTTHD
TTVHFQSDYSQNKQGFRLSFQAYQLSSCPDPNPFRNGLVMGAEYTVGSSVSFRCLPGYTL
VGHPILSCRHGRSRNWDHPIPTCQ
Download sequence
Identical sequences S4RMN0
ENSPMAP00000006466 ENSPMAP00000006466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]