SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000006907 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000006907
Domain Number 1 Region: 2999-3256
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-56
Family YWTD domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 1242-1507
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.0000019
Further Details:      
 
Domain Number 3 Region: 1861-2118
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-48
Family YWTD domain 0.0000147
Further Details:      
 
Domain Number 4 Region: 1557-1814
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-45
Family YWTD domain 0.000023
Further Details:      
 
Domain Number 5 Region: 3842-4113
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-44
Family YWTD domain 0.00000444
Further Details:      
 
Domain Number 6 Region: 511-763
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-44
Family YWTD domain 0.00000825
Further Details:      
 
Domain Number 7 Region: 182-446
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-37
Family YWTD domain 0.0000746
Further Details:      
 
Domain Number 8 Region: 2227-2445
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-29
Family YWTD domain 0.0000689
Further Details:      
 
Domain Number 9 Region: 2899-2990,3249-3310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-23
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 10 Region: 1145-1234,1500-1552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000165
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 11 Region: 821-861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 12 Region: 3622-3667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 3338-3378
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 14 Region: 3581-3617
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000117
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 15 Region: 862-904
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000119
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 3539-3578
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 17 Region: 902-941
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 19 Region: 987-1026
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00015
Further Details:      
 
Domain Number 20 Region: 2711-2755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 21 Region: 3500-3539
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 22 Region: 3417-3454
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 23 Region: 947-984
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 24 Region: 1030-1070
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00021
Further Details:      
 
Domain Number 25 Region: 2673-2709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 2824-2861
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 27 Region: 3456-3497
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 28 Region: 3380-3418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 2536-2577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 30 Region: 128-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 31 Region: 2505-2547
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 2577-2616
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 33 Region: 3302-3335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 1076-1113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 35 Region: 1816-1865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000325
Family EGF-type module 0.011
Further Details:      
 
Domain Number 36 Region: 1116-1151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 37 Region: 2630-2665
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 38 Region: 2873-2909
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000547
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 39 Region: 3756-3802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000681
Family EGF-type module 0.022
Further Details:      
 
Domain Number 40 Region: 3667-3700
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000851
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 41 Region: 48-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000101
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 42 Region: 3708-3747
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000812
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 2125-2174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000155
Family EGF-type module 0.013
Further Details:      
 
Domain Number 44 Region: 4203-4239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.027
Further Details:      
 
Domain Number 45 Region: 780-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000599
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000006907
Domain Number - Region: 4168-4200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4239-4272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000133
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 4340-4375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000356
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4276-4309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00037
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 3795-3826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-type module 0.0098
Further Details:      
 
Domain Number - Region: 4116-4147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0399
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000006907   Gene: ENSPMAG00000006126   Transcript: ENSPMAT00000006937
Sequence length 4512
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476372:206090:427891:-1 gene:ENSPMAG00000006126 transcript:ENSPMAT00000006937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKTCSPTQFVCKDGLTCISLGWRCDGEKDCPDGSDESPEICQKPNEMKCQVNHYHCLGT
ELCIHMSKLCDGNNDCPDGYDEGTHCREFAENCTVTLCRHKCAVTREGPACYCTVGHEVT
PDEKGCKDFDECAVYGTCSQNCLNTDGSYSCSCVEGYLLQPDSKSCKAKNDPVDRPAALL
IANSQNVVATYLNGSIVPGLTPVATRQASAMDFSYSEEMACWVNVGDSPTESRLHCARLA
GLKGFSGERVINISLNVHHVEQMAIDWLTGNFYFMDDVDDRIFVCNKQGDTCVTLLDLEL
YNPKAIALDPTMGKLFFTDYGQIPKVERCDMDGGNCSKLVDSKIVFPHGIALDLVSRLVY
WADAYLDYIEVVDYEGRNRRTIIQGPSVEHLFGLSVFENYLYATSIDNSNSPQNTTVIRV
NRFNSTDYQVLTRVVKGGALHIYHRRRQPTGGSHPCAPDQYGKPGGCSDICLLASSHKTR
TCRCRSGFSLGSDGKSCKMCITNLCLLKRLSRPGIIRGMDVTGRVQDEFMIPIENLVNPR
AVDFHAETGYVYFADTTNFLVARQKIDGTERETILKTNINNVEGIAVDWMGYNLYWTDDG
LKTINVARLEKASQARRTLIEGNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAW
MDGTHRSIFVSSKTVLWPNGLSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQELS
HPFGLTHHGHNIFWTEYRLGTVYRYDTISRNTTVLRNERPPIFEIRTYDREQQKSGTNAC
HVNNGGCSILCLAVPEGRACACADDQLLDADNITCKPNPDYTPPPQCHPGEFACKNGRCI
QERWRCDGDNDCLDNSDEAPEICHQHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDES
NTTCAARTCPPNQFSCASGHCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLTQFACNNG
RCINMNWRCDADNDCADASDEIGCNHSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDET
NPNCTKLATRPPGGCHGDEFQCKADGQCIPLRWRCDGDTDCIDTSDEKECDGVVRTCDPT
LQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGCETMLCKPPSHSCANDSSICLSPKKLCD
GHSDCPDGSDEGMLCDQCQVNNGGCTHNCTVAPGEGVVCSCPSGMQLGKDKKSCDFMDYC
ARHLRCSQRCEQEKSIVKCGCYDGWMLMPDGENCQSLDPFVPFIIFSNRHEIRRIDLHKG
DYSVLVPGLRNTIAIDFHLNQSSLYWTDVVEDKIYHGKLSETGGLTSVEVVVQHGLATPE
GLAVDWIAGNIYWVESNLDQIEVARLNGTMRSTLVAGGIEHPRAIALDPRYGILFWTDWD
SSFPRIEAISMSGTGRHVIHHEMGAGGWPNGLTVDYLENRIMWIDARSDSIYSALYDGTE
LIEVLRGHEFLSHPFAVTLFGGEVYWTDWRTNTLVRANKWTGQNVTVVQRTNTQPFDLHV
FHPTRQPMANNPCGDNEGRGPCSHHCLINYNRTAACTCPHLMKLQPDKRTCSEHWKFLLY
ARQMEIRGVDIDAPYYNFIISFTVPDIDNVTAVDFHGAEQRIYWSDVRTQTIKRAFINGT
NVETIVSADLANAHGLAVDWISGNLYWTSYDANKKQINVARMDGSFKTAVLQGLDKPHGL
ALHPIKGKMYWTDGDTINVANMDGSEKAILHSQQKGPVGLSIDYEESKLYWISSGNGTIN
RCELDGSGLEIVETMKSKLTKPSALAIMGDKLWWADQASEQLGTCSKRDGSNAVVLRNST
ANVMHLRVYDRDLQKGTNPCSVNNGNCAQLCLPRSETVPTCRCTAGYNLQADQRNCEGIG
AFLLYSVHEGIRGIPLDPADKTDALVPISGTSLAVGIDFHAGNDTIYWVDMGLSSIHRAK
RDQTWREDIITNGLGRVEGIAVDWIAGNIYWIDQGFDVIEVARLNGSFRYVVISQGLDKP
RAIAVHPDKGYLFWTEWGQNPRIERSRLDGTERTVLVNVSIAWPNGISVDYEEDKLYWCD
ARTDKIERIDLETGENREVVLSTSNMDMFSVSVFGDYIYWSDRTHANGSIKRGSKENATD
VVALRTGIGVQLKDVKVFNKERQKGTNVCARQNGGCEQLCLYRGKARRMCACAHGLLAED
GVSCRDYDGYLLYSERTILKSVHLFDELNLNAPVRPFEDPEHMKNVIALAFDYGSGPRST
SGGVPYRRRRIFFSDIHFGNIQQLFNDGTGRRVIVENVGSVEGLAYHRGWDSLYWTSYTT
STITRHTVDQARPGAFDRETVVTMSADDHPRAFVMDECLNLMFWTNWNELSPSIMRSFLS
GANVQVIVGSNIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVVILRSEPVHSF
GLAVYGDFVFWTDWVRRAVLRANKFTGTDVKVLRGEIPQQPMGMIALANDTNSCELSPCK
VMNGGCEDLCLITEDGRVNCKCRGERVLVDGTRCVARKNSCDLQTEFECNNGDCIRYHLT
CDGVADCKDKSDEKPFYCTSRQCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNS
TCGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNST
SLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGPCIPTAWKCDREPDCD
DGADELNCDMLCAVDHFECDNGKCITKRWMCDGEDDCGDRSDEKDAHCTFRACANIAYSA
LHLTIVITSHWLHNHSRCCLLPTEQSIYMRILNVSTRKHVCVCVPMHARRLSVHSSLTVS
FADYPMCGPNQFRCANGRCLLKSSWECDGDFDCHDRSDEAPINPHCSANNSKCNDSSSFP
CANGRCVNESMLCNNQDDCEDGSDERNCNINECADRRISGCTQECTDLKIGYKCKCRAGF
QLKDDGKTCVDRDECRTTYPCSQTCLNSHGSFKCLCTDGYRQRVNDSTSCKAISDEEAIL
IFANRYYLRKVNLDGSNYTLLKQGLNNAVALDFEWSEQWVYWTDVTTQGSMIRRMHMNGS
DTQVLHRTSLSNPDGLAVDWIGGNLYWCDKGRDTIEVSKLNGLYRTVLLNNGLKEPRALA
VDVRGGYLYWSDWGEHPHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYWADARED
YIQFADMDGANRHTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGADRTTLIST
LHRPMDLHVYHPFRQPDVPNHPCKVNNGGCSNLCLISPGGQYKCACPTNFYLASDGRTCL
SNCTASRFVCKNDKCIPFWWKCDTEDDCGDRSDEPADCPDFKCRPGQFQCKNGICTNPAF
ICDGDNDCGDGSDEANCDVHVCLPSQFKCRTTHRCIPGIFRCNGQDNCGDGEDEKDCPEV
TCAPNQFQCSSTKRCIPRVWVCDRDNDCGDGSDEPANCTQMTCGQEEFRCKGTGRCIPSR
WKCDGDDDCGDTSDEPKEECEDRTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCT
PRPCSESEFSCANGRCIAGRWRCDGDHDCSDGSDEKDCSPRCDHDQFQCRNGHCIPQRWR
CDADIDCIDGSDEDNCAAIVRTCPHHEFQCNNTLCKPLSWKCDGEDDCGDNSDETPEMCL
KFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICNSSEFKCGGT
ERKCISTQLVCNRFDDCGDGGSDEVACGGDQFVNECHRPLNPCGDDAICHDTLRGYYCEC
KPGFQRKATTSICEDVNECAQFGVCTQLCNNTKGSYKCNCSKNYIKGLHHSCKAEGSEQM
VLYIADNNEIRSLAPNNPNMAYEQAYQGDATVRIDAMDAHVKSNRIFWTNWHMGRISMLE
LYPAGEHRHRRQTSGTVVDLDISGLKMPRGVAVDWVADNLYWTDSGRDVIEVAQLRGHYR
KTLVSGMIDEPHAIVLDPIRGQMYWSDWGNNAKIEQASMDGTRRHNFVEKDLQWPTGLAI
DFMNQRLYWADAKLSVIGSIRLDGTDRVVAVDSKQGLLHPFSIEIFEDYIYGVTYVNNRV
FRIHKFGSGTVVNITAGMSHATDIVVFHPLKQPEVINPCEQRKCEWLCLLNPNGATCSCP
NGWALVNGTCLEVPTPTSQPDGSTPGPCTLPCLNGGSCFLNERGLAKCKCQPRFSGERCE
LDQCKEYCQNGGTCMASPSGMPTCRCPNRFTGAQCERKVCDGYCLNGGACSVNAGNQPVC
RCTDAYKGDRCQSTLCDNYCMNGGVCSFAKDGSPLCACHPRFLGTRCDTDRCGHCPGGQC
ELGPGAGDVRCNCTGPACSRCLEFCYNGGLCFWDSVAGRPACQCQPGWEGSQCERNSPNR
STSPDEGKTLSVVVPLVLLALIIVSVVAFFCYRRRVKGAKGFQHQRMTNGAMNVEIGNPT
YNMFEGEAEDDVGELLDADFTLDPDKPTNFTNPVYASLYLDGPSSRNSLGSTDEKKELLS
KSPEEELAEALA
Download sequence
Identical sequences S4RNX1
ENSPMAP00000006907 ENSPMAP00000006907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]