SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007218 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007218
Domain Number 1 Region: 499-581
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-23
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 177-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-18
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000068
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 4 Region: 61-107
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000209
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Domain Number 5 Region: 443-495
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000576
Family Spermadhesin, CUB domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007218   Gene: ENSPMAG00000006549   Transcript: ENSPMAT00000007250
Sequence length 587
Comment pep:novel scaffold:Pmarinus_7.0:GL478943:5730:13341:-1 gene:ENSPMAG00000006549 transcript:ENSPMAT00000007250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCAYDFLKVYGGTSESGQLLATLCGLTIPGVVSAHGPMFLHFHSDPFIEDNGFLAAYQAI
PCGGSFTNPSGFISSPTFGQVNYHNNMNCSYHIQVAEDRIVNLKMKISKSSNTSRYGVDA
VLELRSYIEIYCCEPTDVLPRTILRSRKNTFRHIEHTSQCTTPHRATTPVPQCAGPAQGC
GGMLTGDTGELSSPDINGDGQYENDLDCRWTVSVEPNNLITLTFSAFELESAIQDTCHYD
YVSVRHDPRTNTHQQGRTCVRPAPQHCHVARELWPLANKSLAAIGGGDQSLTRHQVTHAT
RCFRNRFAPSIGWTCYWIIALCIRRCEKGRRAELTTTVDGEVFVACSSEYARRRGTNTGA
QTNDHKHGSTHADETGAACERHPDRSVLPPLEHGNAARFDVSLSICQKKITALKGFTLPD
ITRHVLTPAHHDVVTRDLSSRRKVHNGSDVTAPSLAKLCGAGLPDPVFPRADVLFLRFVS
DFSQALNGYEITWTSSPAGCGGILHGDHGSFTSPDFPGTYPNNSTCEWLLEVAVHRRATL
RFPVFHVDDPGDCERNYLMVHDGPSMSSPPVGTFCGQVSSRFPRVHT
Download sequence
Identical sequences S4RPT2
ENSPMAP00000007218 ENSPMAP00000007218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]