SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007341 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007341
Domain Number 1 Region: 462-721
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.19e-77
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 36-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-31
Family Spermadhesin, CUB domain 0.0000383
Further Details:      
 
Domain Number 3 Region: 198-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-27
Family Spermadhesin, CUB domain 0.0000179
Further Details:      
 
Domain Number 4 Region: 315-386
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 383-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000584
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 148-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000162
Family EGF-type module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007341   Gene: ENSPMAG00000006616   Transcript: ENSPMAT00000007373
Sequence length 723
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL476930:20137:36223:-1 gene:ENSPMAG00000006616 transcript:ENSPMAT00000007373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQLRLLLLPLLLLLPQCTPSGDNGEEALGEVHDVCGLHGSIQSPGYPGPYPDQALHTWH
ISVPSGYRARLQFAHFDLETSVKCQYDYVKVSAGNESLDNFCGQESMDGEHVPGNQLIVA
SGNSINVTLRTDFSNEERFTGFKAYFTAVDINECVEGDAGGNEQACQHNCYNYPGGFHCS
CRYGYQLDQDDRTCTVECSGQEFTERRGEVTSPEYPRPYPRALQCKFTLRLEEGYLLTLN
FRDTFDVEIHPEIKTCPYDSLTIRSGGRQWGPLCGRSLPDPIETKSSVAEIVFTSDKSGD
NTGWRIHYTSEGIACPSVNALGNGYFEPKQLTYRFKDAIVFSCDTGYKLIQGENGKEADS
LRMTCLNNGTWDRMPPTCKIVDCGFPPLIVHGYTDPFFPTTTYKEKVTFECSDAYRFTTP
TDGVFTCNESGHWTNPLDREKIPSICEPVLCGEPKHPIEQVARIVGGYPARSGNFPWQAL
IRKFSHRGGLQGGGSLINDRWIITAAHVVEDFLPHEIFITLGALNQKLPNSKGSTETRTV
DKRIMHPGYKPNETFFDNDIALLRLAGDPVSMTDTVRPICLPKVTEGRVAPVLVPHHVGF
VSGWGHTKAQIGSTTSQVLKYVELPIVEDNICMETNHDKSVQYYTHNTIVTGNMFCAGYP
QGGKDACQGDSGGPFTIVVEGKFWYLMGLVSWGISCAKADQYGVYTRVDKYLDWLHSEMA
KNK
Download sequence
Identical sequences S4RQ55
ENSPMAP00000007341 ENSPMAP00000007341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]