SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007423 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007423
Domain Number 1 Region: 30-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-34
Family Spermadhesin, CUB domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 192-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-28
Family Spermadhesin, CUB domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 310-374
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000695
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 140-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 379-433
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000751
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007423   Gene: ENSPMAG00000006712   Transcript: ENSPMAT00000007456
Sequence length 440
Comment pep:known_by_projection scaffold:Pmarinus_7.0:GL479007:564:17377:-1 gene:ENSPMAG00000006712 transcript:ENSPMAT00000007456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAFSRSSTRWLLLLLLPAALCGLVAEKQHRLSGMSGSFTSPGYPTPYKNQVLHTWQLSVP
AGYRLRLQFQHFEVEPSYLCEYDYLKVMAGEQQLGLFCGQHSTDTEKVPGKEPILAPSNT
MTVTFRSDYSNEEHYTGFAGHFTAVDIDECVEYAEHEELACNHFCHNYPGGYLCSCRHSF
TLDPDGRTCTVECSGLVFTERQGELSSPEYPKPYPWASQCSYTVRLEEGFVLNLAFQETF
DLELHPHMDNCPYDSLTIRSGGQQWGPLCGKTLPDPIETKSPVAEIIFISDKSGDNIGWK
IHYTSKGTPCPMVVEPAHGFIEPVQDSYSFKDQVVFFCNTGYRLIQPGQEEDNEVVPSLQ
MACQSDGTWSRMAPSSGIVDCGPPLALDNGRGTEADSTTFQASVDYACDEPYYFTMQVGA
KFVCNETGVWMNPETGEKKP
Download sequence
Identical sequences S4RQD7
ENSPMAP00000007423 ENSPMAP00000007423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]