SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000007612 from Petromyzon marinus 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000007612
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-35
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSPMAP00000007612
Domain Number - Region: 140-183
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000484
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000007612   Gene: ENSPMAG00000006907   Transcript: ENSPMAT00000007646
Sequence length 185
Comment pep:novel scaffold:Pmarinus_7.0:GL489134:1272:7172:1 gene:ENSPMAG00000006907 transcript:ENSPMAT00000007646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQIAPTREETARCGVWTDSKWGGTFTSPKYPDPYPPNQDCIYILEAPARQRIELSFSAP
YSLEPSWDCKFDHIEVRDGPFGFSPLIGRFCGHVLPRPVNSTGRFMWVKFFADSELEALG
FRARFTFIPDPDFKTLGSPMPDCEFEMSGTEGVVRSSQIEHERKAQANEAVDCIWKIRAP
PPAKV
Download sequence
Identical sequences S4RQX6
ENSPMAP00000007612 ENSPMAP00000007612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]